LHX8 Antibody - middle region (ARP47492_P050)

Catalog No: ARP47492_P050

WB Suggested Anti-LHX8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Liver

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LHX8
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: EQDVNHPKPAKRARTSFTADQLQVMQAQFAQDNNPDAQTLQKLAERTGLS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-LHX8 (ARP47492_P050) antibody is Catalog # AAP47492 (Previous Catalog # AAPP28330)
• Reference: Qin,Y., (2008) Fertil. Steril. 89 (4), 1012-1014

Target Info

• Gene Symbol: LHX8
• Gene Full Name: LIM homeobox 8
• Alias Symbols: LHX7
• NCBI Gene Id: 431707
• Protein Name: LIM/homeobox protein Lhx8
• Description of Target: LHX8 is a member of the LIM homeobox family. Members of this family share common structural features. They all contain 2 tandemly repeated cysteine-rich double-zinc finger motifs, called LIM domains, in addition to a homeodomain. The homeodomain is a DNA-binding domain, and the LIM domains are essential for regulating the activity of these molecules by interacting with other proteins. Members of the family are required for the patterning or the specification and differentiation of different cell types during embryonic development.Members of the LIM homeobox gene family, such as LHX8, encode transcription regulators that share common structural features. They all contain 2 tandemly repeated cysteine-rich double-zinc finger motifs, called LIM domains, in addition to a homeodomain. The homeodomain is a DNA-binding domain, and the LIM domains are essential for regulating the activity of these molecules by interacting with other proteins. Members of the LIM homeobox gene family are required for the patterning or the specification and differentiation of different cell types during embryonic development (Zhao et al., 1999 [PubMed 10611327]).[supplied by OMIM].
• Uniprot ID: Q68G74
• Protein Accession #: NP_001001933
• Nucleotide Accession #: NM_001001933
• Protein Size (# AA): 356
• Molecular Weight: 39kDa
• Protein Interactions: NUTM1; SCYL3; KLF3; LDB1; SUV39H1;