LHX4 Antibody - middle region (ARP32424_P050)

Catalog No: ARP32424_P050

WB Suggested Anti-LHX4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: 721_B cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LHX4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GSFSMDGTGQSYQDLRDGSPYGIPQSPSSISSLPSHAPLLNGLDYTVDSN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-LHX4 (ARP32424_P050) antibody is Catalog # AAP32424 (Previous Catalog # AAPP03419)
• Reference: Pfaeffle,R.W., (2008) J. Clin. Endocrinol. Metab. 93 (3), 1062-1071

Target Info

• Gene Symbol: LHX4
• Gene Full Name: LIM homeobox 4
• Alias Symbols: CPHD4
• NCBI Gene Id: 89884
• Protein Name: LIM/homeobox protein Lhx4
• Description of Target: LHX4 is a member of a large protein family which contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and be involved in control of differentiation and development of the pituitary gland. Mutations in this gene are associated with syndromic short stature and pituitary and hindbrain defects.This gene encodes a member of a large protein family which contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and be involved in control of differentiation and development of the pituitary gland. Mutations in this gene are associated with syndromic short stature and pituitary and hindbrain defects. An alternative splice variant has been described but its biological nature has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P53776
• Protein Accession #: NP_203129
• Nucleotide Accession #: NM_033343
• Protein Size (# AA): 390
• Molecular Weight: 43kDa
• Protein Interactions: FDX1L; LONRF1; TXNDC5; SNRNP25; CHCHD2; ORC6; USP2; SH2D1A; LDB2; SSX1; ISL1; IFT172;