LGALS9C Antibody - C-terminal region (ARP70764_P050)

Catalog No: ARP70764_P050

Host: Rabbit
Target Name: LGALS9C
Sample Tissue: Human Hela Whole Cell
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human LGALS9C
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 91%; Rabbit: 91%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: RFDENAVVRNTQINNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-LGALS9C (ARP70764_P050) antibody is Catalog # AAP70764

Target Info

• Gene Symbol: LGALS9C
• Alias Symbols: Gal-9B, LGALS9B
• NCBI Gene Id: 654346
• Protein Name: Galectin-9C
• Description of Target: This gene was initially thought to represent a pseudogene of galectin 9; however, this transcript has good exon-intron structure and encodes a predicted protein of the same size as and highly similar to galectin 9. This gene is one of two similar loci on chromosome 17p similar to galectin 9 and now thought to be protein-encoding. This gene is the more telomeric gene.
• Uniprot ID: Q6DKI2
• Protein Accession #: NP_001035167
• Nucleotide Accession #: NM_001040078
• Protein Size (# AA): 356
• Molecular Weight: 39kDa
• Protein Interactions: RBPMS; PLSCR1; DAB1;