Lbxcor1 Antibody - middle region (ARP37517_P050)

Catalog No: ARP37517_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-Lbxcor1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Mouse Kidney

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse Lbxcor1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 86%; Mouse: 100%; Rabbit: 86%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: EPDKEDNHSTTADDLETRKSFSDQRSVSQPSPANTDRGEDGLTLDVTGTQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Skor1 (ARP37517_P050) antibody is Catalog # AAP37517 (Previous Catalog # AAPP09623)

Target Info

• Gene Symbol: Skor1
• Gene Full Name: SKI family transcriptional corepressor 1
• Alias Symbols: Co, Lbxc, Corl1, Lbxcor1, AV273001, C230094B15Rik
• NCBI Gene Id: 207667
• Protein Name: SKI family transcriptional corepressor 1
• Description of Target: Lbxcor1 inhibits BMP signaling. Lbxcor1 acts as a transcriptional corepressor of LBX1.
• Uniprot ID: Q8BX46
• Protein Accession #: NP_766034
• Nucleotide Accession #: NM_172446
• Protein Size (# AA): 964
• Molecular Weight: 100kDa
• Protein Interactions: Hdac1; Zbtb16; Tle1; Pcbp2; Lbx1;