KPTN Antibody - N-terminal region (ARP58488_P050)

Catalog No: ARP58488_P050

WB Suggested Anti-KPTN Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KPTN
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
• Peptide Sequence: Synthetic peptide located within the following region: MGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KPTN (ARP58488_P050) antibody is Catalog # AAP58488 (Previous Catalog # AAPP34571)
• Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Target Info

• Gene Symbol: KPTN
• Gene Full Name: Kaptin (actin binding protein)
• Alias Symbols: 2E4, KICS4, MRT41
• NCBI Gene Id: 11133
• Protein Name: Kaptin
• Description of Target: KPTN may be involved in actin dynamics. KPTN may play a role in producing the sensory apparatus in hair cells. KPTN may also play a role in actin rearrangements that accompany platelet activation and stereocilia formation.
• Uniprot ID: Q9Y664
• Protein Accession #: NP_008990
• Nucleotide Accession #: NM_007059
• Protein Size (# AA): 436
• Molecular Weight: 47kDa
• Protein Interactions: SRPK1; APP; ACTC1; RAB25; ITFG2; PKIG; TSPAN7; AUP1;