website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

KITLG antibody - middle region (ARP44354_P050)

Description of Target:
KITLG is the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis.This gene encodes the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis. Two transcript variants encoding different isoforms have been found for this gene.
Gene Symbol:
Official Gene Full Name:
KIT ligand
NCBI Gene Id:
Alias Symbols:
DKFZp686F2250; KL-1; Kitl; MGF; SCF; SF; FPH2; SHEP7; kit-ligand
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KITLG.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KITLG.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
Kit ligand
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen is a synthetic peptide directed towards the middle region of human KITLG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
Anti-KITLG (ARP44354_P050)
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Species Reactivity:
Cow; Dog; Goat; Guinea Pig; Horse; Human; Mouse; Pig; Rabbit; Rat; Sheep
Datasheets / Downloads:
Printable datasheet for anti-KITLG (ARP44354_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG
Blocking Peptide:
For anti-KITLG (ARP44354_P050) antibody is Catalog # AAP44354 (Previous Catalog # AAPS14802)
Additional Information:
IHC Information: Placenta
IHC Information: Lung
Target Reference:
Kasamatsu,S., (2008) J. Invest. Dermatol. 128 (7), 1763-1772
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: KITLG antibody tested with Human Hepg2 Cells (ARP44354_P050)

Aviva Systems Biology is the original manufacturer of this KITLG antibody (ARP44354_P050)

Click here to view the KITLG antibody Western Blot Protocol

Product Datasheet Link: KITLG antibody (ARP44354_P050)

WB Suggested Anti-KITLG Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2

Western Blot image:

Description of Target: KITLG is the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis.This gene encodes the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis. Two transcript variants encoding different isoforms have been found for this gene.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s KITLG antibody (ARP44354_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question