website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

KITLG antibody - middle region (ARP44354_P050)

Description of Target:
KITLG is the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis.This gene encodes the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis. Two transcript variants encoding different isoforms have been found for this gene.
Gene Symbol:
Official Gene Full Name:
KIT ligand
NCBI Gene Id:
Alias Symbols:
DKFZp686F2250; KL-1; Kitl; MGF; SCF; SF; FPH2; SHEP7; kit-ligand
Tissue Tool:
Find tissues and cell lines supported to express KITLG.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Kit ligand
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-KITLG antibody: synthetic peptide directed towards the middle region of human KITLG
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
KITLG antibody - middle region (ARP44354_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%
Species Reactivity:
Pig, Rat, Horse, Rabbit, Sheep, Mouse, Human, Dog, Bovine, Goat, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-KITLG antibody
- ARP44354_P050
Peptide Sequence:
Synthetic peptide located within the following region: TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG
Blocking Peptide:
For anti-KITLG antibody is Catalog # AAP44354 (Previous Catalog # AAPS14802)
Additional Information:
IHC Information: Placenta
IHC Information: Lung
Key Reference:
Kasamatsu,S., (2008) J. Invest. Dermatol. 128 (7), 1763-1772
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-KITLG antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question