website statistics
Account Login 

Aviva Systems Biology office will be closed for Thanksgiving - Thursday 11/27/2014 and Friday 11/28/2014.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

KITLG antibody - middle region (ARP44354_P050)

Description of Target:
KITLG is the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis.This gene encodes the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis. Two transcript variants encoding different isoforms have been found for this gene.
Gene Symbol:
Official Gene Full Name:
KIT ligand
NCBI Gene Id:
Alias Symbols:
DKFZp686F2250; KL-1; Kitl; MGF; SCF; SF; FPH2; SHEP7; kit-ligand
Tissue Tool:
Find tissues and cell lines supported to express KITLG.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Kit ligand
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-KITLG antibody: synthetic peptide directed towards the middle region of human KITLG
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
KITLG antibody - middle region (ARP44354_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%
Species Reactivity:
Pig, Rat, Horse, Rabbit, Sheep, Mouse, Human, Dog, Bovine, Goat, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-KITLG antibody
- ARP44354_P050
Peptide Sequence:
Synthetic peptide located within the following region: TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG
Blocking Peptide:
For anti-KITLG antibody is Catalog # AAP44354 (Previous Catalog # AAPS14802)
Additional Information:
IHC Information: Placenta
IHC Information: Lung
Target Reference:
Kasamatsu,S., (2008) J. Invest. Dermatol. 128 (7), 1763-1772
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-KITLG antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for KITLG antibody (ARP44354)

Product page for KITLG antibody (ARP44354)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant KITLG antibody; Loxodonta africana KITLG antibody G3SXX2 100%
American mink SCF antibody; Mustela vison SCF antibody Q95N18 100%
Bovine SCF antibody; Bos taurus SCF antibody Q28132 100%
Cat SCF antibody; Felis catus SCF antibody P79169 100%
Chicken KITLG antibody; Gallus gallus KITLG antibody Q009U6 100%
Chicken KITLG antibody; Gallus gallus KITLG antibody Q009U4 100%
Chicken SCF antibody; Gallus gallus SCF antibody Q09108 100%
Chinese hamster LOC100752139 antibody; Cricetulus griseus LOC100752139 antibody G3HII0 100%
Common turkey KITLG antibody; Meleagris gallopavo KITLG antibody G3UUE5 100%
Common turkey KITLG antibody; Meleagris gallopavo KITLG antibody G1NFD2 100%
Dog Cfa.1 antibody; Canis familiaris Cfa.1 antibody F1Q0S6 100%
Dog SCF antibody; Canis familiaris SCF antibody Q06220 100%
Duckbill platypus KITLG antibody; Ornithorhynchus anatinus KITLG antibody F7C5I3 92%
Goat SCF antibody; Capra hircus SCF antibody Q95M19 100%
Gray short-tailed opossum KITLG antibody; Monodelphis domestica KITLG antibody F7EP53 100%
Gray short-tailed opossum KITLG antibody; Monodelphis domestica KITLG antibody F6V6V5 100%
Gray short-tailed opossum KITLG antibody; Monodelphis domestica KITLG antibody F6V6T8 100%
Guinea pig KITLG antibody; Cavia porcellus KITLG antibody H0V3W5 92%
Horse KITLG antibody; Equus caballus KITLG antibody F7CCA2 100%
Horse SCF antibody; Equus caballus SCF antibody Q95MD2 100%
Human SCF antibody; Homo sapiens SCF antibody P21583 100%
Human SCF antibody; Homo sapiens SCF antibody P21583-3 100%
Japanese quail SCF antibody; Coturnix coturnix japonica SCF antibody Q90314 100%
Little brown bat KITLG antibody; Myotis lucifugus KITLG antibody G1NWC8 92%
Lowland gorilla KITLG antibody; Gorilla gorilla gorilla KITLG antibody G3S7Q2 100%
Lowland gorilla KITLG antibody; Gorilla gorilla gorilla KITLG antibody G3S4K2 100%
Mouse Kitl antibody; Mus musculus Kitl antibody Q78ED8 100%
Mouse Kitl antibody; Mus musculus Kitl antibody E9Q671 100%
Mouse SCF antibody; Mus musculus SCF antibody P20826 100%
Mus sp. Kitl antibody Q64384 100%
Northern white-cheeked gibbon LOC100587810 antibody; Nomascus leucogenys LOC100587810 antibody G1R0E6 100%
Pig KITL antibody; Sus scrofa KITL antibody B0B2G9 100%
Pig SCF antibody; Sus scrofa SCF antibody Q29030 100%
Rabbit KL antibody; Oryctolagus cuniculus KL antibody Q2I093 100%
Rat Kitlg antibody; Rattus norvegicus Kitlg antibody F1LYJ6 100%
Rat SCF antibody; Rattus norvegicus SCF antibody P21581 100%
Rhesus macaque KITLG antibody; Macaca mulatta KITLG antibody F6SDB0 100%
Sheep SCF antibody; Ovis aries SCF antibody P79368 100%
Sheep SCF antibody; Ovis aries SCF antibody G8Z9W4 100%
Sheep SCF antibody; Ovis aries SCF antibody G8Z9W2 100%
Small-eared galago KITLG antibody; Otolemur garnettii KITLG antibody H0X0Z3 100%
Tasmanian devil KITLG antibody; Sarcophilus harrisii KITLG antibody G3VV70 100%
Tasmanian devil KITLG antibody; Sarcophilus harrisii KITLG antibody G3VV69 100%
White-tufted-ear marmoset LOC100410844 antibody; Callithrix jacchus LOC100410844 antibody F7GD96 85%
White-tufted-ear marmoset LOC100410844 antibody; Callithrix jacchus LOC100410844 antibody F7G0Y4 85%
White-tufted-ear marmoset LOC100410844 antibody; Callithrix jacchus LOC100410844 antibody F7G0W2 85%
Zebra finch KITLG antibody; Taeniopygia guttata KITLG antibody H0ZCI0 100%

Product Protocols: KITLG antibody tested with Human Hepg2 Cells (ARP44354_P050)

Aviva Systems Biology is the original manufacturer of this KITLG antibody (ARP44354_P050)

Click here to view the KITLG antibody Western Blot Protocol

Product Datasheet Link: KITLG antibody (ARP44354_P050)

WB Suggested Anti-KITLG Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2

Western Blot image:

Description of Target: KITLG is the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis.This gene encodes the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis. Two transcript variants encoding different isoforms have been found for this gene.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s KITLG antibody (ARP44354_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question