website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

KITLG antibody - middle region (ARP44354_P050)

Description of Target:
KITLG is the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis.This gene encodes the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis. Two transcript variants encoding different isoforms have been found for this gene.
Gene Symbol:
KITLG
Official Gene Full Name:
KIT ligand
NCBI Gene Id:
4254
Alias Symbols:
DKFZp686F2250; KL-1; Kitl; MGF; SCF; SF; FPH2; SHEP7; kit-ligand
Tissue Tool:
Find tissues and cell lines supported to express KITLG.
Protein Accession #:
NP_000890
Nucleotide Accession#:
NM_000899
Swissprot Id:
P21583
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Kit ligand
Protein Size (# AA):
273
Molecular Weight:
28kDa
Application:
WB, IHC
Protein Interactions:
UBC; CLEC11A; UBE2V1; PIK3CD; FLT3LG; KITLG; KIT; CSF2; EPOR; CMA1;
Immunogen:
The immunogen for anti-KITLG antibody: synthetic peptide directed towards the middle region of human KITLG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
KITLG antibody - middle region (ARP44354_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%
Species Reactivity:
Pig, Rat, Horse, Rabbit, Sheep, Mouse, Human, Dog, Bovine, Goat, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-KITLG antibody
- ARP44354_P050
Peptide Sequence:
Synthetic peptide located within the following region: TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG
Blocking Peptide:
For anti-KITLG antibody is Catalog # AAP44354 (Previous Catalog # AAPS14802)
Additional Information:
IHC Information: Placenta
IHC Information: Lung
Target Reference:
Kasamatsu,S., (2008) J. Invest. Dermatol. 128 (7), 1763-1772
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: KITLG antibody tested with Human Hepg2 Cells (ARP44354_P050)

Aviva Systems Biology is the original manufacturer of this KITLG antibody (ARP44354_P050)

Click here to view the KITLG antibody Western Blot Protocol

Product Datasheet Link: KITLG antibody (ARP44354_P050)

WB Suggested Anti-KITLG Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2

Western Blot image:


Description of Target: KITLG is the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis.This gene encodes the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis. Two transcript variants encoding different isoforms have been found for this gene.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s KITLG antibody (ARP44354_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question