KCNN2 Antibody - middle region (ARP35439_P050)

Catalog No: ARP35439_P050

WB Suggested Anti-KCNN2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Muscle

Host: Rabbit
Target Name: KCNN2
Sample Type: Human Fetal Heart
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: KCNN2
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: KCNN2
Sample Type: Human Fetal Muscle
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target: KCNN2
Positive control (+): Human liver (LI)
Negative control (-): HeLa (HL)
Antibody concentration: 1ug/ml

Sample Type:
Rhesus macaque spinal cord
Primary Antibody Dilution:
1:300
Secondary Antibody:
Donkey anti Rabbit 488
Secondary Antibody Dilution:
1:500
Color/Signal Descriptions:
Green: KCNN2
Gene Name:
KCNN2
Submitted by:
Timur Mavlyutov, Ph. D., Department of Pharmacology, University of Wisconsin Medical School, 1300 University Avenue, Madison, WI 53706

Product Info

• Tested Species Reactivity: Human, Monkey
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCNN2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KCNN2 (ARP35439_P050) antibody is Catalog # AAP35439 (Previous Catalog # AAPP06677)
• Reference: Morimoto,T., (2007) J. Pharmacol. Sci. 104 (1), 94-98
• Publications:

  Chakroborty, S. et al. Early presynaptic and postsynaptic calcium signaling abnormalities mask underlying synaptic depression in presymptomatic Alzheimer’s disease mice. J. Neurosci. 32, 8341-53 (2012). 22699914

Target Info

• Gene Symbol: KCNN2
• Gene Full Name: Potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2
• Alias Symbols: SK2, hSK2, SKCA2, KCa2.2, SKCa 2
• NCBI Gene Id: 3781
• Protein Name: Potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2 EMBL AAH15371.1
• Description of Target: KCNN2 is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. This protein is a member of the KCNN family of potassium channel genes. Two transcript variants encoding different isoforms have been found for KCNN2.Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. KCNN2 is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP.Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by this gene is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. This gene is a member of the KCNN family of potassium channel genes. Two transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: Q6PJI0
• Protein Accession #: NP_740721
• Nucleotide Accession #: NM_170775
• Protein Size (# AA): 231
• Molecular Weight: 26kDa
• Protein Interactions: SRPK2; SRPK1; UBC; ACTN2; KCNN2; CALM1;