Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP35090_T100
Price: $0.00
SKU
ARP35090_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-KCNK3 (ARP35090_T100) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human KCNK3
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 100%
Peptide SequenceSynthetic peptide located within the following region: TCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGL
Concentration1.0 mg/ml
Blocking PeptideFor anti-KCNK3 (ARP35090_T100) antibody is Catalog # AAP35090 (Previous Catalog # AAPP08952)
ReferenceRusznak,Z., et al., (2004) Cell. Mol. Life Sci. 61 (12), 1532-1542
Publications

Donner, B. C. et al. Functional role of TASK-1 in the heart: studies in TASK-1-deficient mice show prolonged cardiac repolarization and reduced heart rate variability. Basic Res. Cardiol. 106, 75-87 (2011). 20978771

Nogueira, E. F., Gerry, D., Mantero, F., Mariniello, B. & Rainey, W. E. The role of TASK1 in aldosterone production and its expression in normal adrenal and aldosterone-producing adenomas. Clin. Endocrinol. (Oxf). 73, 22-9 (2010). 19878209

Gene SymbolKCNK3
Gene Full NamePotassium channel, subfamily K, member 3
Alias SymbolsOAT1, PPH4, TASK, TASK1, TBAK1, K2p3.1, TASK-1
NCBI Gene Id3777
Protein NamePotassium channel subfamily K member 3
Description of TargetKCNK3 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The gene product is an outwardly rectifying channel that is sensitive to changes in extracellular pH and is inhibited by extracellular acidification. Also referred to as an acid-sensitive potassium channel, it is activated by the anesthetics halothane and isoflurane. Although three transcripts are detected in northern blots, there is currently no sequence available to confirm transcript variants for this gene.
Uniprot IDO14649
Protein Accession #NP_002237
Nucleotide Accession #NM_002246
Protein Size (# AA)394
Molecular Weight43kDa
Protein InteractionsYWHAB; COPB1; YWHAG; YWHAE; SFN; YWHAZ; YWHAQ; S100A10; YWHAH;
  1. What is the species homology for "KCNK3 Antibody - C-terminal region (ARP35090_T100)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Sheep".

  2. How long will it take to receive "KCNK3 Antibody - C-terminal region (ARP35090_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "KCNK3 Antibody - C-terminal region (ARP35090_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "KCNK3 Antibody - C-terminal region (ARP35090_T100)"?

    This target may also be called "OAT1, PPH4, TASK, TASK1, TBAK1, K2p3.1, TASK-1" in publications.

  5. What is the shipping cost for "KCNK3 Antibody - C-terminal region (ARP35090_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KCNK3 Antibody - C-terminal region (ARP35090_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "KCNK3 Antibody - C-terminal region (ARP35090_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "43kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KCNK3 Antibody - C-terminal region (ARP35090_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "KCNK3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KCNK3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KCNK3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KCNK3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KCNK3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KCNK3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KCNK3 Antibody - C-terminal region (ARP35090_T100)
Your Rating
We found other products you might like!