- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
KCNK10 Antibody - C-terminal region (ARP35325_T100)
| Datasheets/Manuals | Printable datasheet for anti-KCNK10 (ARP35325_T100) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human KCNK10 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 79%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: EDVQKIYKTFRNYSLDEEKKEEETEKMCNSDNSSTAMLTDCIQQHAELEN |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-KCNK10 (ARP35325_T100) antibody is Catalog # AAP35325 (Previous Catalog # AAPP06561) |
| Reference | Gu,W., et al., (2002) J. Physiol. (Lond.) 539 (PT 3), 657-668 |
| Gene Symbol | KCNK10 |
|---|---|
| Gene Full Name | Potassium channel, subfamily K, member 10 |
| Alias Symbols | TREK2, TREK-2, K2p10.1, PPP1R97 |
| NCBI Gene Id | 54207 |
| Protein Name | Potassium channel subfamily K member 10 |
| Description of Target | KCNK10 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The message for this gene is highly expressed in the kidney and pancreas. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations. The protein is stimulated strongly by arachidonic acid and to a lesser degree by membrane stretching, intracellular acidification, and general anaesthetics. Three transcript variants have been identified for this gene. |
| Uniprot ID | P57789 |
| Protein Accession # | NP_066984 |
| Nucleotide Accession # | NM_021161 |
| Protein Size (# AA) | 538 |
| Molecular Weight | 59kDa |
| Protein Interactions | PPP1CA; UBC; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "KCNK10 Antibody - C-terminal region (ARP35325_T100)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".
-
How long will it take to receive "KCNK10 Antibody - C-terminal region (ARP35325_T100)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "KCNK10 Antibody - C-terminal region (ARP35325_T100)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "KCNK10 Antibody - C-terminal region (ARP35325_T100)"?
This target may also be called "TREK2, TREK-2, K2p10.1, PPP1R97" in publications.
-
What is the shipping cost for "KCNK10 Antibody - C-terminal region (ARP35325_T100)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "KCNK10 Antibody - C-terminal region (ARP35325_T100)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "KCNK10 Antibody - C-terminal region (ARP35325_T100)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "59kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "KCNK10 Antibody - C-terminal region (ARP35325_T100)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "KCNK10"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "KCNK10"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "KCNK10"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "KCNK10"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "KCNK10"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "KCNK10"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
