KCNK1 Antibody - middle region (ARP35089_P050)

Catalog No: ARP35089_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-KCNK1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCNK1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: EDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KCNK1 (ARP35089_P050) antibody is Catalog # AAP35089 (Previous Catalog # AAPP08951)
• Reference: Goldstein,S.A., (2005) Pharmacol. Rev. 57 (4), 527-540

Target Info

• Gene Symbol: KCNK1
• Gene Full Name: Potassium channel, subfamily K, member 1
• Alias Symbols: DPK, HOHO, K2P1, KCNO1, TWIK1, K2p1.1, TWIK-1
• NCBI Gene Id: 3775
• Protein Name: Potassium channel subfamily K member 1
• Description of Target: KCNK1 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK1 has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: O00180
• Protein Accession #: NP_002236
• Nucleotide Accession #: NM_002245
• Protein Size (# AA): 336
• Molecular Weight: 38kDa
• Protein Interactions: KRTAP10-3; TCIRG1; UBC; ELAVL1; UBE2I; SENP1; KCNK1;