JAB1 Antibody (OABB01973)

Catalog No: OABB01973

Size:100UG

Click here to learn more about Aviva's By-Request Conjugation Service.

Anti-JAB1 Picoband antibody, OABB01973, Western blotting
All lanes: Anti JAB1 (OABB01973) at 0.5ug/ml
Lane 1: Rat Testis Tissue Lysate at 50ug
Lane 2: Mouse Testis Tissue Lysate at 50ug
Lane 3: HELA Whole Cell Lysate at 40ug
Lane 4: 293T Whole Cell Lysate at 40ug
Predicted bind size: 38KD
Observed bind size: 38KD

Anti-JAB1 Picoband antibody, OABB01973, IHC(P)
IHC(P): Human Mammary Cancer Tissue

Anti-JAB1 Picoband antibody, OABB01973, IHC(P)
IHC(P): Mouse Testis Tissue

Anti-JAB1 Picoband antibody, OABB01973, IHC(P)
IHC(P): Rat Testis Tissue

Product Info

• Tested Species Reactivity: Human, Mouse, Rat
• Predicted Species Reactivity: Bovine|Chicken|Dog|Horse|Human|Mouse|Rabbit|Rat
• Product Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Clonality: Polyclonal
• Clone: Polyclonal
• Isotype: Rabbit IgG
• Host: Rabbit
• Application: Flow cytometry|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Frozen|Western blot
• Additional Information: Notes: Tested Species: In-house tested species with positive results.
  By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
  Other applications have not been tested.
  Optimal dilutions should be determined by end users.
  Background: COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis), also known as COPS5 or JAB1, is a gene conserved from humans to Saccharomyces cerevisiae. It is a member of the MOV34 family. COPS5 is mapped to 8q13.1. The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. COPS5 can interact with the cytoplasmic domain of the beta-2 subunit of the alpha-L/beta-2 integrin LFA1, and it is the only protein demonstrated to interact with MIF. COPS5, VHL, and TRC8 proteins appear to be linked both physically and functionally, and all 3 may participate in the development of kidney cancer. In addition to that, COPS5 is an essential cofactor for the apoptotic function of E2F1.
• Reconstitution and Storage: 2°C to 8°C|-20°C
• Immunogen: E.coli-derived human JAB1 recombinant protein (Position: M8-S334). Human JAB1 shares 99.4% amino acid (aa) sequence identity with mouse JAB1.
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: MAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS
• Concentration: 500 ug/ml
• Specificity: No cross reactivity with other proteins.
• Application Info: Western blot: 0.1-0.5 ug/ml: Human, Mouse, Rat
  Immunohistochemistry (Paraffin-embedded Section): 0.5-1 ug/ml: Human, Mouse, Rat: By Heat
  Immunohistochemistry (Frozen Section): 0.5-1 ug/ml: Human
  Immunocytochemistry/Immunofluorescence: 2 ug/ml: Human
  Flow Cytometry: 1-3 ug/1x10^6 cells: Human
• Reference: 1. Bianchi, E., Denti, S., Granata, A., Bossi, G., Geginat, J., Villa, A., Rogge, L., Pardi, R.Integrin LFA-1 interacts with the transcriptional co-activator JAB1 to modulate AP-1 activity. Nature 404: 617-621, 2000.
  2. "Entrez Gene: COPS5 COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis)".
  3. Hallstrom, T. C., Nevins, J. R. Jab1 is a specificity factor for E2F1-induced apoptosis.Genes Dev. 20: 613-623, 2006.
  
• Storage Buffer: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Description: Rabbit IgG polyclonal antibody for COP9 signalosome complex subunit 5(COPS5) detection. Tested with WB, IHC-P, IHC-F, ICC/IF, FCM in Human;Mouse;Rat.

Target Info

• Gene Symbol: COPS5
• Gene Full Name: COP9 signalosome subunit 5
• Alias Symbols: 38 kDa Mov34 homolog;COP9 constitutive photomorphogenic homolog subunit 5;COP9 signalosome complex subunit 5;CSN5;JAB1;jun activation domain-binding protein 1;MOV-34;SGN5;signalosome subunit 5;testis secretory sperm-binding protein Li 231m.
• NCBI Gene Id: 10987
• Protein Name: COP9 signalosome complex subunit 5
• Description of Target: Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. In the complex, it probably acts as the catalytic center that mediates the cleavage of Nedd8 from cullins. It however has no metalloprotease activity by itself and requires the other subunits of the CSN complex. Interacts directly with a large number of proteins that are regulated by the CSN complex, confirming a key role in the complex. Promotes the proteasomal degradation of BRSK2.
• Uniprot ID: Q92905
• Molecular Weight: 37579 MW