IL1B Antibody - N-terminal region (ARP54323_P050)

Catalog No: ARP54323_P050

WB Suggested Anti-IL1B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Hela cell lysate

WB Suggested Anti-IL1B Antibody
Positive Control: Lane 1: 80ug rat brain extract Lane 2: 80ug mouse brain extract
Primary Antibody Dilution : 1:500
Secondary Antibody : IRDye 800 CW goat anti-rabbit from Li-COR Bioscience
Secondry Antibody Dilution : 1:20,000
Submitted by: Dr. Yuzhi Chen, University of Arkansas for Medical Science

Host: Rabbit
Target: IL1B
Positive control (+): Human lung (LU)
Negative control (-): Human Ovary (OV)
Antibody concentration: 3ug/ml

Human Macrophage

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Dog, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IL1B
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 92%; Horse: 86%; Human: 100%; Mouse: 75%; Rabbit: 92%
• Peptide Sequence: Synthetic peptide located within the following region: MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-IL1B (ARP54323_P050) antibody is Catalog # AAP54323 (Previous Catalog # AAPP43207)
• Publications:

  1a,25-dihydroxyvitamin D3 and resolvin D1 retune the balance between amyloid-β phagocytosis and inflammation in Alzheimer's disease patients. J Alzheimers Dis. 34, 155-70 (2012). 23186989

  Circulating microparticles enhanced rat vascular wall remodeling following endothelial denudation. Am J Transl Res. 8, 4511-4522 (2016). 27904658

  Wang, F. et al. Shigella flexneri T3SS effector IpaH4.5 modulates the host inflammatory response via interaction with NF-κB p65 protein. Cell. Microbiol. 15, 474-85 (2013). 23083102

• Description:
  View product citations for IL1B Antibody - N-terminal region (ARP54323_P050) on CiteAb

Target Info

• Gene Symbol: IL1B
• Gene Full Name: Interleukin 1, beta
• Alias Symbols: IL-1, IL1F2, IL1beta, IL1-BETA
• NCBI Gene Id: 3553
• Protein Name: Interleukin-1 beta
• Description of Target: IL1B is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. The gene encoding IL1B and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.
• Uniprot ID: P01584
• Protein Accession #: NP_000567
• Nucleotide Accession #: NM_000576
• Protein Size (# AA): 269
• Molecular Weight: 17
• Protein Interactions: PTPN1; LYN; FYN; CMA1; CASP1; APP; SP1; EGR1; ELAVL1; CASP4; IL1RAP; PRTN3; IL1R2; IL1R1; IL1B; MMP2; ADRB2; A2M; UBE2N; ZNF675; MAPK8IP2;