IL13RA1 Antibody - N-terminal region (ARP63414_P050)

Catalog No: ARP63414_P050

WB Suggested Anti-IL13RA1 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal kidney

Sample Type:
Lane 1: 60ug mouse CT26 lysate Lane 2: 60ug mouse MC38 lysate Primary Antibody Dilution:
1:1000 Secondary Antibody:
Anti-rabbit-HRP Secondary Antibody Dilution:
1:5000 Color/Signal Descriptions:
IL13RA1 Gene Name:
Miranda A. Hallett, Vanderbilt University Medical Center Submitted by:

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of IL13RA1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 85%; Guinea Pig: 77%; Horse: 92%; Human: 100%; Mouse: 85%; Pig: 85%; Rabbit: 100%; Rat: 86%; Sheep: 92%
• Peptide Sequence: Synthetic peptide located within the following region: VSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVP
• Concentration: 0.5 mg/ml
• Blocking Peptide: Available upon request
• Subunit: alpha-1

Target Info

• Gene Symbol: IL13RA1
• Alias Symbols: NR4, CT19, CD213A1, IL-13Ra
• NCBI Gene Id: 3597
• Protein Name: Interleukin-13 receptor subunit alpha-1
• Description of Target: The protein encoded by this gene is a subunit of the interleukin 13 receptor. This subunit forms a receptor complex with IL4 receptor alpha, a subunit shared by IL13 and IL4 receptors. This subunit serves as a primary IL13-binding subunit of the IL13 receptor, and may also be a component of IL4 receptors. This protein has been shown to bind tyrosine kinase TYK2, and thus may mediate the signaling processes that lead to the activation of JAK1, STAT3 and STAT6 induced by IL13 and IL4.
• Uniprot ID: P78552
• Protein Accession #: NP_001551
• Nucleotide Accession #: NM_001560
• Protein Size (# AA): 427
• Molecular Weight: 47kDa
• Protein Interactions: UBC; IL2RG; TMEM39B; ELAVL1; TRAF3IP1; DLG4; TYK2; IL4R; IL13;