- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-IKBKG (ARP30006_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human IKBKG |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 79%; Dog: 93%; Guinea Pig: 85%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 86%; Rat: 86% |
Peptide Sequence | Synthetic peptide located within the following region: MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPET |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-IKBKG (ARP30006_P050) antibody is Catalog # AAP30006 (Previous Catalog # AAPH00106) |
Reference | Salminen,A., (2008) Biochem. Biophys. Res. Commun. 367 (4), 715-718 |
Gene Symbol | IKBKG |
---|---|
Gene Full Name | Inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma |
Alias Symbols | IP, IP1, IP2, FIP3, IKKG, IPD2, NEMO, FIP-3, Fip3p, IMD33, AMCBX1, EDAID1, IKKAP1, ZC2HC9, IKK-gamma |
NCBI Gene Id | 8517 |
Protein Name | NF-kappa-B essential modulator |
Description of Target | IKBKG is the regulatory subunit of the IKK core complex which phosphorylates inhibitors of NF-kappa-B thus leading to the dissociation of the inhibitor/NF-kappa-B complex and ultimately the degradation of the inhibitor. IKBKG also considered to be a mediator for TAX activation of NF-kappa-B. IKBKG could be implicated in NF-kappa-B-mediated protection from cytokine toxicity.Familial incontinentia pigmenti (IP) is a genodermatosis that segregates as an X-linked dominant disorder and is usually lethal prenatally in males (The International Incontinentia Pigmenti Consortium, 2000 [PubMed 10839543]). In affected females it causes highly variable abnormalities of the skin, hair, nails, teeth, eyes, and central nervous system. The prominent skin signs occur in 4 classic cutaneous stages: perinatal inflammatory vesicles, verrucous patches, a distinctive pattern of hyperpigmentation, and dermal scarring. Cells expressing the mutated X chromosome are eliminated selectively around the time of birth, so females with IP exhibit extremely skewed X-inactivation. Familial incontinentia pigmenti is caused by mutations in the NEMO gene and is here referred to as IP2, or 'classical' incontinentia pigmenti. Sporadic incontinentia pigmenti, the so-called IP1, which maps to Xp11, is categorized as hypomelanosis of Ito (MIM 300337).[supplied by OMIM]. Sequence Note: removed 1 base from the 5' end that did not align to the reference genome assembly. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2120 AF261086.1 2-2121 |
Uniprot ID | Q9Y6K9 |
Protein Accession # | NP_003630 |
Nucleotide Accession # | NM_003639 |
Protein Size (# AA) | 419 |
Molecular Weight | 48kDa |
Protein Interactions | CHUK; IKBKB; ATM; PIAS4; MALT1; TRIM13; BCL10; SUMO1; UBC; TRAF6; MTOR; RPTOR; RELA; NFKBIA; IKBKG; ARHGDIA; RHOA; CDC37; SRC; FYN; FKBP5; FGR; PPP4C; PPP2R1B; LYN; NMRAL1; USP7; ZC3H12A; IRAK1; USP10; RIPK1; SQSTM1; RNF31; PPP1CC; HDLBP; PPFIA1; PSMB8; K |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "IKBKG Antibody - N-terminal region (ARP30006_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".
-
How long will it take to receive "IKBKG Antibody - N-terminal region (ARP30006_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "IKBKG Antibody - N-terminal region (ARP30006_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "IKBKG Antibody - N-terminal region (ARP30006_P050)"?
This target may also be called "IP, IP1, IP2, FIP3, IKKG, IPD2, NEMO, FIP-3, Fip3p, IMD33, AMCBX1, EDAID1, IKKAP1, ZC2HC9, IKK-gamma" in publications.
-
What is the shipping cost for "IKBKG Antibody - N-terminal region (ARP30006_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "IKBKG Antibody - N-terminal region (ARP30006_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "IKBKG Antibody - N-terminal region (ARP30006_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "48kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "IKBKG Antibody - N-terminal region (ARP30006_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "IKBKG"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "IKBKG"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "IKBKG"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "IKBKG"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "IKBKG"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "IKBKG"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.