IGSF11 Antibody - middle region (ARP44704_P050)

Catalog No: ARP44704_P050

WB Suggested Anti-IGSF11 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IGSF11
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: EKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-IGSF11 (ARP44704_P050) antibody is Catalog # AAP44704 (Previous Catalog # AAPP12176)
• Enhanced Validation:

  Relative Expression (Western Blot)

• Reference: Harada,H., (2005) J. Cell. Physiol. 204 (3), 919-926

Target Info

• Gene Symbol: IGSF11
• Gene Full Name: Immunoglobulin superfamily, member 11
• Alias Symbols: CT119, VSIG3, Igsf13, BT-IgSF, CXADRL1
• NCBI Gene Id: 152404
• Protein Name: Immunoglobulin superfamily member 11
• Description of Target: IGSF11 functions as a cell adhesion molecule through homophilic interaction. IGSF11 stimulates cell growth.IGSF11 is an immunoglobulin (Ig) superfamily member that is preferentially expressed in brain and testis. It shares significant homology with coxsackievirus and adenovirus receptor (CXADR; MIM 602621) and endothelial cell-selective adhesion molecule (ESAM).[supplied by OMIM].
• Uniprot ID: Q5DX21
• Protein Accession #: NP_001015887
• Nucleotide Accession #: NM_001015887
• Protein Size (# AA): 431
• Molecular Weight: 46 kDa
• Protein Interactions: IGSF11;