IGLL1 Antibody - N-terminal region (ARP42547_T100)

Catalog No: ARP42547_T100

WB Suggested Anti-IGLL1 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysateIGLL1 is supported by BioGPS gene expression data to be expressed in Jurkat

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IGLL1
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: RSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKAT
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-IGLL1 (ARP42547_T100) antibody is Catalog # AAP42547 (Previous Catalog # AAPP26422)
• Sample Type Confirmation:

  IGLL1 is supported by BioGPS gene expression data to be expressed in Jurkat

• Reference: Bourne,P.C., Acta Crystallogr. D Biol. Crystallogr. 58 (PT 5), 815-823 (2002)

Target Info

• Gene Symbol: IGLL1
• Gene Full Name: Immunoglobulin lambda-like polypeptide 1
• Alias Symbols: IGO, 14.1, AGM2, IGL1, IGL5, IGLL, IGVPB, CD179b, VPREB2, IGLJ14.1
• NCBI Gene Id: 3543
• Protein Name: Immunoglobulin lambda-like polypeptide 1
• Description of Target: The preB cell receptor is found on the surface of proB and preB cells, where it is involved in transduction of signals for cellular proliferation, differentiation from the proB cell to the preB cell stage, allelic exclusion at the Ig heavy chain gene locus, and promotion of Ig light chain gene rearrangements. The preB cell receptor is composed of a membrane-bound Ig mu heavy chain in association with a heterodimeric surrogate light chain. IGLL1 is one of the surrogate light chain subunits and is a member of the immunoglobulin gene superfamily. Mutations in its gene can result in B cell deficiency and agammaglobulinemia, an autosomal recessive disease in which few or no gamma globulins or antibodies are made.The preB cell receptor is found on the surface of proB and preB cells, where it is involved in transduction of signals for cellular proliferation, differentiation from the proB cell to the preB cell stage, allelic exclusion at the Ig heavy chain gene locus, and promotion of Ig light chain gene rearrangements. The preB cell receptor is composed of a membrane-bound Ig mu heavy chain in association with a heterodimeric surrogate light chain. This gene encodes one of the surrogate light chain subunits and is a member of the immunoglobulin gene superfamily. This gene does not undergo rearrangement. Mutations in this gene can result in B cell deficiency and agammaglobulinemia, an autosomal recessive disease in which few or no gamma globulins or antibodies are made. Two transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: P15814
• Protein Accession #: NP_064455
• Nucleotide Accession #: NM_020070
• Protein Size (# AA): 213
• Molecular Weight: 19kDa
• Protein Interactions: MYOC; IGLL1;