- Description of Target:
- Igf2bp1 is a RNA-binding factor that affects mRNA nuclear export, localization, stability and translation.
- Gene Symbol:
- Igf2bp1
- Official Gene Full Name:
- Insulin-like growth factor 2 mRNA binding protein 1
- Alias Symbols:
- AL024068; AW549074; CRD-BP; Crdbp; D030026A21Rik; D11Moh40e; D11Moh45; IMP-1; Neilsen; Zbp1
- Tissue Tool:
- Find tissues and cell lines supported to express Igf2bp1.
- Protein Accession# :
- NP_034081
- Nucleotide Accession#:
- NM_009951
- Swissprot Id:
- O88477
- Host:
- Rabbit
- Protein Size (# AA):
- 577
- Molecular Weight:
- 63kDa
- Application:
- WB
- Product Format:
- Lyophilized powder
- Complete computational species homology data:
- Igf2bp1 antibody - N-terminal region (ARP58385_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Rat: 100%
- Datasheets / Downloads:
- Printable datasheet for
anti-Igf2bp1 antibody
- ARP58385_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: PQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKL
- Blocking Peptide:
- For anti-Igf2bp1 antibody is Catalog # AAP58385
- Key Reference:
- N/A
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-Igf2bp1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
