Catalog No: ARP58385_P050
Price: $0.00
SKU
ARP58385_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-Igf2bp1 (ARP58385_P050) antibody
Product Info
Tested Species ReactivityMouse, Rat
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: PQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKL
Concentration0.5 mg/ml
Blocking PeptideFor anti-Igf2bp1 (ARP58385_P050) antibody is Catalog # AAP58385
Gene SymbolIgf2bp1
Gene Full NameInsulin-like growth factor 2 mRNA binding protein 1
Alias SymbolsIM, Crd, IMP, Zbp, CRD-, IMP1, Zbp1, Crdbp, IMP-1, ZBP-1, CRD-BP, D11Moh4, Neilsen, AL024068, AW549074, D11Moh40, D11Moh45, mir-3063, D11Moh40e, D030026A21Rik
NCBI Gene Id140486
Protein NameInsulin-like growth factor 2 mRNA-binding protein 1
Description of TargetIgf2bp1 is a RNA-binding factor that affects mRNA nuclear export, localization, stability and translation.
Uniprot IDO88477
Protein Accession #NP_034081
Nucleotide Accession #NM_009951
Protein Size (# AA)577
Molecular Weight63kDa
Protein InteractionsEed; Nanog; Ywhae;
  1. What is the species homology for "Igf2bp1 Antibody - N-terminal region (ARP58385_P050)"?

    The tested species reactivity for this item is "Mouse, Rat". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "Igf2bp1 Antibody - N-terminal region (ARP58385_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Igf2bp1 Antibody - N-terminal region (ARP58385_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Igf2bp1 Antibody - N-terminal region (ARP58385_P050)"?

    This target may also be called "IM, Crd, IMP, Zbp, CRD-, IMP1, Zbp1, Crdbp, IMP-1, ZBP-1, CRD-BP, D11Moh4, Neilsen, AL024068, AW549074, D11Moh40, D11Moh45, mir-3063, D11Moh40e, D030026A21Rik" in publications.

  5. What is the shipping cost for "Igf2bp1 Antibody - N-terminal region (ARP58385_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Igf2bp1 Antibody - N-terminal region (ARP58385_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Igf2bp1 Antibody - N-terminal region (ARP58385_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "63kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Igf2bp1 Antibody - N-terminal region (ARP58385_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "IGF2BP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "IGF2BP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "IGF2BP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "IGF2BP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "IGF2BP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "IGF2BP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Igf2bp1 Antibody - N-terminal region (ARP58385_P050)
Your Rating
We found other products you might like!