website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

ID2 antibody - middle region (P100939_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Inhibitor of DNA binding 2, dominant negative helix-loop-helix protein
Protein Name:
DNA-binding protein inhibitor ID-2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
GIG8, ID2A, ID2H, MGC26389, bHLHb26
Description of Target:
ID2 belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation.The protein encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ID2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ID2.
The immunogen is a synthetic peptide directed towards the middle region of human ID2
Species Reactivity:
Cow, Human, Mouse, Pig, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Human: 100%; Mouse: 100%; Pig: 92%; Rat: 100%
Complete computational species homology data:
Anti-ID2 (P100939_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ID2 (P100939_P050) antibody is Catalog # AAP31292 (Previous Catalog # AAPP02041)
Datasheets / Downloads:
Printable datasheet for anti-ID2 (P100939_P050) antibody
Target Reference:
Yang,J., (2008) Circ. Res. 102 (10), 1212-1221

Product Protocols: ID2 antibody tested with Human Fetal Thymus Tissue (P100939_P050)

Aviva Systems Biology is the original manufacturer of this ID2 antibody (P100939_P050)

Click here to view the ID2 antibody Western Blot Protocol

Product Datasheet Link: ID2 antibody (P100939_P050)

WB Suggested Anti-ID2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Fetal Thymus

Western Blot image:

Description of Target: ID2 belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation.The protein encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s ID2 antibody (P100939_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocol: ID2 Antibody (P100939_P050) in Human Liver Tissue using Immunohistochemistry

Aviva Systems Biology is the original manufacturer of this ID2 antibody.
Product Datasheet Link: ID2 antibody P100939_P050

Rabbit Anti-ID2 Antibody
Catalog Number: P100939_P050
Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
Observed Staining: Nucleus in hepatocytes
Primary Antibody Concentration: 1:100
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Left to right:
DAPI, ID2 Ab, Merge

Control Image:
Control Antibody: Normal Rabbit IgG
Control Antibody Concentration: 1:100

Left to right:
DAPI, Rabbit IgG, Merge

1. Normal adult human liver tissue was formalin fixed, embedded in paraffin wax, sectioned at 6 micron thickness and put on histological slides.
2. After deparaffinization and rehydration, the low pH, heat-induced antigen retrieval method utilizing Sodium Citrate buffer was performed.
3. The blocking buffer was 5% normal goat serum.
4. Primary antibodies was diluted in antibody dilution buffer (1% Normal Donkey Serum) to the final testing dilution (1:100, 1:600, 1:1200).
5. The appropriate anti-rabbit fluorescent-conjugated (Rhodamine:red or FITC:green) secondary antibody was applied and nuclei will be counterstained with DAPI (blue).
6. A Negative control utilized a nonspecific rabbit IgG staining the same normal adult human liver tissue.

Ask a Question