website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

ID2 antibody - middle region (P100939_P050)

Description of Target:
ID2 belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation.The protein encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
Inhibitor of DNA binding 2, dominant negative helix-loop-helix protein
NCBI Gene Id:
Alias Symbols:
GIG8; ID2A; ID2H; MGC26389; bHLHb26
Tissue Tool:
Find tissues and cell lines supported to express ID2.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
DNA-binding protein inhibitor ID-2
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-ID2 antibody: synthetic peptide directed towards the middle region of human ID2
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
ID2 antibody - middle region (P100939_P050)
Predicted Homology Based on Immunogen Sequence:
Bovine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Pig: 92%; Chicken: 84%
Species Reactivity:
Bovine, Human, Mouse, Pig, Rat
Datasheets / Downloads:
Printable datasheet for
anti-ID2 antibody
- P100939_P050
Peptide Sequence:
Synthetic peptide located within the following region: TIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALC
Blocking Peptide:
For anti-ID2 antibody is Catalog # AAP31292 (Previous Catalog # AAPP02041)
Key Reference:
Yang,J., (2008) Circ. Res. 102 (10), 1212-1221
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-ID2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question