website statistics
Account Login 

Aviva Systems Biology office will be closed for Memorial Day - 5/25/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

ID2 antibody - middle region (P100939_P050)

Description of Target:
ID2 belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation.The protein encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
Inhibitor of DNA binding 2, dominant negative helix-loop-helix protein
NCBI Gene Id:
Alias Symbols:
GIG8; ID2A; ID2H; MGC26389; bHLHb26
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ID2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ID2.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
DNA-binding protein inhibitor ID-2
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-ID2 antibody: synthetic peptide directed towards the middle region of human ID2
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
ID2 antibody - middle region (P100939_P050)
Predicted Homology Based on Immunogen Sequence:
Bovine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Pig: 92%; Chicken: 84%
Species Reactivity:
Bovine, Human, Mouse, Pig, Rat
Datasheets / Downloads:
Printable datasheet for
anti-ID2 antibody
- P100939_P050
Peptide Sequence:
Synthetic peptide located within the following region: TIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALC
Blocking Peptide:
For anti-ID2 antibody is Catalog # AAP31292 (Previous Catalog # AAPP02041)
Target Reference:
Yang,J., (2008) Circ. Res. 102 (10), 1212-1221
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for ID2 antibody (P100939)

Product page for ID2 antibody (P100939)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant LOC100662671 antibody; Loxodonta africana LOC100662671 antibody G3SZ38 100%
Bovine ID2 antibody; Bos taurus ID2 antibody Q3ZC46 100%
Chicken ID2 antibody; Gallus gallus ID2 antibody O73933 84%
Chicken ID2 antibody; Gallus gallus ID2 antibody F1NSW7 84%
Chicken ID2 antibody; Gallus gallus ID2 antibody F1NLJ5 84%
Common turkey LOC100549717 antibody; Meleagris gallopavo LOC100549717 antibody G1NMI0 84%
Crab-eating macaque ID2 antibody; Macaca fascicularis ID2 antibody Q4R5J7 100%
Duckbill platypus LOC100084227 antibody; Ornithorhynchus anatinus LOC100084227 antibody F7FSY1 92%
Giant panda LOC100481765 antibody; Ailuropoda melanoleuca LOC100481765 antibody D2HLK9 100%
Gray short-tailed opossum LOC100028188 antibody; Monodelphis domestica LOC100028188 antibody F6ZDF6 92%
Green anole LOC100560759 antibody; Anolis carolinensis LOC100560759 antibody G1KAW9 100%
Guinea pig LOC100729886 antibody; Cavia porcellus LOC100729886 antibody H0VYR6 85%
Horse LOC100057240 antibody; Equus caballus LOC100057240 antibody F6TGB5 100%
Human ID2 antibody; Homo sapiens ID2 antibody Q02363 100%
Human ID2 antibody; Homo sapiens ID2 antibody Q53T66 100%
Human ID2 antibody; Homo sapiens ID2 antibody Q53H99 100%
Japanese common newt newt Id2 antibody; Cynops pyrrhogaster newt Id2 antibody Q9W619 76%
Japanese quail Id2 antibody; Coturnix coturnix japonica Id2 antibody Q3LSV1 84%
Mouse ID2 antibody; Mus musculus ID2 antibody P41136 100%
Mouse Id2 antibody; Mus musculus Id2 antibody Q545T4 100%
Naked mole rat Id2 antibody; Heterocephalus glaber Id2 antibody E5RUY0 78%
Northern white-cheeked gibbon LOC100602551 antibody; Nomascus leucogenys LOC100602551 antibody G1RRW6 100%
Pig ID2 antibody; Sus scrofa ID2 antibody Q2VIU1 92%
Pig ID2 antibody; Sus scrofa ID2 antibody D2EDR1 92%
Rat ID2 antibody; Rattus norvegicus ID2 antibody P41137 100%
Rhesus macaque ID2 antibody; Macaca mulatta ID2 antibody F7DNR9 100%
Small-eared galago ID2 antibody; Otolemur garnettii ID2 antibody H0X780 100%
Sumatran orangutan ID2 antibody; Pongo abelii ID2 antibody Q5RCH7 100%
Tasmanian devil ID2 antibody; Sarcophilus harrisii ID2 antibody G3WLK5 92%
White-tufted-ear marmoset LOC100408338 antibody; Callithrix jacchus LOC100408338 antibody F7I6I5 100%
Zebra finch LOC100224948 antibody; Taeniopygia guttata LOC100224948 antibody H0ZRZ0 92%

Product Protocols: ID2 antibody tested with Human Fetal Thymus Tissue (P100939_P050)

Aviva Systems Biology is the original manufacturer of this ID2 antibody (P100939_P050)

Click here to view the ID2 antibody Western Blot Protocol

Product Datasheet Link: ID2 antibody (P100939_P050)

WB Suggested Anti-ID2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Fetal Thymus

Western Blot image:

Description of Target: ID2 belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation.The protein encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s ID2 antibody (P100939_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question