Catalog No: P100939_P050
Price: $0.00
SKU
P100939_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ID2 (P100939_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ID2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Human: 100%; Mouse: 100%; Pig: 92%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: TIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALC
Concentration0.5 mg/ml
Blocking PeptideFor anti-ID2 (P100939_P050) antibody is Catalog # AAP31292 (Previous Catalog # AAPP02041)
ReferenceYang,J., (2008) Circ. Res. 102 (10), 1212-1221
Description
Gene SymbolID2
Gene Full NameInhibitor of DNA binding 2, dominant negative helix-loop-helix protein
Alias SymbolsGIG8, ID2A, ID2H, bHLHb26
NCBI Gene Id3398
Protein NameDNA-binding protein inhibitor ID-2
Description of TargetID2 belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation.The protein encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ02363
Protein Accession #NP_002157
Nucleotide Accession #NM_002166
Protein Size (# AA)134
Molecular Weight15kDa
Protein InteractionsASB4; UBC; SUV39H2; PRMT6; KDM1A; SUV39H1; TCF12; TCF3; TSTA3; MAPK8; ID2; HSPA5; RBL2; RBL1; RB1; CDK2; USP1; MAPK3; MAPK1; E2F4; SIN3A; GATA4; NKX2-5; LRIF1; PPP1CA; RBM48; NEDD9; UNC119; MSC; TCF4; ELK3; ELK4; ELK1; PAX8; PAX5; PAX2; MYF6; MYF5; MYOG;
  1. What is the species homology for "ID2 Antibody - middle region (P100939_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Pig".

  2. How long will it take to receive "ID2 Antibody - middle region (P100939_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ID2 Antibody - middle region (P100939_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ID2 Antibody - middle region (P100939_P050)"?

    This target may also be called "GIG8, ID2A, ID2H, bHLHb26" in publications.

  5. What is the shipping cost for "ID2 Antibody - middle region (P100939_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ID2 Antibody - middle region (P100939_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ID2 Antibody - middle region (P100939_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "15kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ID2 Antibody - middle region (P100939_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ID2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ID2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ID2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ID2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ID2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ID2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ID2 Antibody - middle region (P100939_P050)
Your Rating