website statistics
Account Login 

Aviva Systems Biology office will be closed for Independence Day - 7/3/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

ID2 antibody - middle region (P100939_P050)

Description of Target:
ID2 belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation.The protein encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
Inhibitor of DNA binding 2, dominant negative helix-loop-helix protein
NCBI Gene Id:
Alias Symbols:
GIG8; ID2A; ID2H; MGC26389; bHLHb26
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ID2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ID2.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
DNA-binding protein inhibitor ID-2
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen is a synthetic peptide directed towards the middle region of human ID2
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
Anti-ID2 (P100939_P050)
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Human: 100%; Mouse: 100%; Pig: 92%; Rat: 100%
Species Reactivity:
Cow; Human; Mouse; Pig; Rat
Datasheets / Downloads:
Printable datasheet for anti-ID2 (P100939_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: TIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALC
Blocking Peptide:
For anti-ID2 (P100939_P050) antibody is Catalog # AAP31292 (Previous Catalog # AAPP02041)
Target Reference:
Yang,J., (2008) Circ. Res. 102 (10), 1212-1221
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: ID2 antibody tested with Human Fetal Thymus Tissue (P100939_P050)

Aviva Systems Biology is the original manufacturer of this ID2 antibody (P100939_P050)

Click here to view the ID2 antibody Western Blot Protocol

Product Datasheet Link: ID2 antibody (P100939_P050)

WB Suggested Anti-ID2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Fetal Thymus

Western Blot image:

Description of Target: ID2 belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation.The protein encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s ID2 antibody (P100939_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question