HYOU1 Antibody - middle region (ARP46716_P050)

Catalog No: ARP46716_P050

WB Suggested Anti-HYOU1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: RPMI 8226 cell lysateHYOU1 is supported by BioGPS gene expression data to be expressed in RPMI 8226

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HYOU1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: DREVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASASDQGEKVIPPAGQT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HYOU1 (ARP46716_P050) antibody is Catalog # AAP46716 (Previous Catalog # AAPP27518)
• Sample Type Confirmation:

  HYOU1 is supported by BioGPS gene expression data to be expressed in RPMI 8226

• Publications:

  Expression and function of HSP110 family in mouse testis after vasectomy. Asian J. Androl. (2016). 26952955

Target Info

• Gene Symbol: HYOU1
• Gene Full Name: Hypoxia up-regulated 1
• Alias Symbols: IMD59, Grp170, HSP12A, ORP150, GRP-170, ORP-150
• NCBI Gene Id: 10525
• Protein Name: Hypoxia up-regulated protein 1
• Description of Target: The protein encoded by this gene belongs to the heat shock protein 70 family. This gene uses alternative transcription start sites. A cis-acting segment found in the 5' UTR is involved in stress-dependent induction, resulting in the accumulation of this protein in the endoplasmic reticulum (ER) under hypoxic conditions. The protein encoded by this gene is thought to play an important role in protein folding and secretion in the ER. Since suppression of the protein is associated with accelerated apoptosis, it is also suggested to have an important cytoprotective role in hypoxia-induced cellular perturbation. This protein has been shown to be up-regulated in tumors, especially in breast tumors, and thus it is associated with tumor invasiveness. This gene also has an alternative translation initiation site, resulting in a protein that lacks the N-terminal signal peptide. This signal peptide-lacking protein, which is only 3 amino acids shorter than the mature protein in the ER, is thought to have a housekeeping function in the cytosol. In rat, this protein localizes to both the ER by a carboxy-terminal peptide sequence and to mitochondria by an amino-terminal targeting signal.
• Uniprot ID: Q9Y4L1
• Protein Accession #: NP_006380
• Nucleotide Accession #: NM_006389
• Protein Size (# AA): 999
• Molecular Weight: 108kDa
• Protein Interactions: CLU; HSPA8; UBC; MDM2; RNF2; EZH2; KIF13A; ARMCX3; GANAB; BCAR1; ATP6V1F; XRCC5; MCM7; MCM2; MSH6; XRCC6; ATP6V1B2; BIN1; UBD; env; OS9; NUP37; POLR1C; FBXO6; CDK2; SIRT7; SARM1; H2AFX; IKBKE; EXT2;