website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

HSPA4L antibody - C-terminal region (ARP53693_P050)

Description of Target:
HSPA4L belongs to the heat shock protein 70 family. HSPA4L possesses chaperone activity in vitro where it inhibits aggregation of citrate synthase.
Gene Symbol:
Official Gene Full Name:
Heat shock 70kDa protein 4-like
NCBI Gene Id:
Alias Symbols:
APG-1; Osp94; HSPH3
Tissue Tool:
Find tissues and cell lines supported to express HSPA4L.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Heat shock 70 kDa protein 4L
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-HSPA4L antibody: synthetic peptide directed towards the C terminal of human HSPA4L
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
HSPA4L antibody - C-terminal region (ARP53693_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Zebrafish: 80%
Species Reactivity:
Human, Rat, Bovine, Pig, Horse, Rabbit, Guinea pig, Mouse, Dog, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-HSPA4L antibody
- ARP53693_P050
Peptide Sequence:
Synthetic peptide located within the following region: KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI
Blocking Peptide:
For anti-HSPA4L antibody is Catalog # AAP53693 (Previous Catalog # AAPP30535)
Target Reference:
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-HSPA4L antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for HSPA4L antibody (ARP53693)

Product page for HSPA4L antibody (ARP53693)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant HSPA4L antibody; Loxodonta africana HSPA4L antibody G3SLN5 92%
Bovine Bt.96746 antibody; Bos taurus Bt.96746 antibody E1BBT9 92%
Chicken HSPA4L antibody; Gallus gallus HSPA4L antibody Q5F3J8 84%
Chicken HSPA4L antibody; Gallus gallus HSPA4L antibody F1NC26 84%
Common turkey HSPA4L antibody; Meleagris gallopavo HSPA4L antibody G1MZM6 84%
Dog HSPA4L antibody; Canis familiaris HSPA4L antibody E2RRM6 85%
Duckbill platypus HSPA4L antibody; Ornithorhynchus anatinus HSPA4L antibody F6PGK4 76%
Giant panda HSPA4L antibody; Ailuropoda melanoleuca HSPA4L antibody D2HIW9 92%
Gray short-tailed opossum HSPA4 antibody; Monodelphis domestica HSPA4 antibody F6SEX9 81%
Green anole HSPA4 antibody; Anolis carolinensis HSPA4 antibody G1KNK5 83%
Green anole hspa4l antibody; Anolis carolinensis hspa4l antibody G1KLL7 81%
Guinea pig HSPA4L antibody; Cavia porcellus HSPA4L antibody H0V8F4 92%
Horse LOC100063623 antibody; Equus caballus LOC100063623 antibody F6Q7Y7 92%
Human HS74L antibody; Homo sapiens HS74L antibody O95757 100%
Human HSPA4L antibody; Homo sapiens HSPA4L antibody Q53ZP9 100%
Human HSPA4L antibody; Homo sapiens HSPA4L antibody E9PDE8 100%
Human HSPA4L antibody; Homo sapiens HSPA4L antibody E7ES43 100%
Human HSPA4L antibody; Homo sapiens HSPA4L antibody A2ICT2 100%
Little brown bat HSPA4L antibody; Myotis lucifugus HSPA4L antibody G1NZ98 92%
Mouse HS74L antibody; Mus musculus HS74L antibody P48722 92%
Mouse HS74L antibody; Mus musculus HS74L antibody P48722-2 92%
Mouse Hspa4l antibody; Mus musculus Hspa4l antibody Q3TTD4 92%
Northern white-cheeked gibbon HSPA4L antibody; Nomascus leucogenys HSPA4L antibody G1RTJ3 92%
Pig HSPA4L antibody; Sus scrofa HSPA4L antibody F1RRA7 92%
Rabbit HSPA4L antibody; Oryctolagus cuniculus HSPA4L antibody G1U0U5 92%
Rat Hspa4l antibody; Rattus norvegicus Hspa4l antibody B4F772 92%
Rhesus macaque HSPA4L antibody; Macaca mulatta HSPA4L antibody F6VUK9 92%
Small-eared galago HSPA4L antibody; Otolemur garnettii HSPA4L antibody H0WSS3 92%
Tasmanian devil HSPA4 antibody; Sarcophilus harrisii HSPA4 antibody G3WLC8 90%
Tasmanian devil HSPA4 antibody; Sarcophilus harrisii HSPA4 antibody G3WLC7 90%
Tasmanian devil PLK4 antibody; Sarcophilus harrisii PLK4 antibody G3WKI0 90%
White-tufted-ear marmoset HSPA4L antibody; Callithrix jacchus HSPA4L antibody F7IPW8 92%
White-tufted-ear marmoset HSPA4L antibody; Callithrix jacchus HSPA4L antibody F7DZL3 92%
White-tufted-ear marmoset HSPA4L antibody; Callithrix jacchus HSPA4L antibody F7DZE4 92%
Zebra finch LOC100220950 antibody; Taeniopygia guttata LOC100220950 antibody H0YV26 84%

Product Protocols: HSPA4L antibody tested with Human Fetal Brain Tissue (ARP53693_P050)

Aviva Systems Biology is the original manufacturer of this HSPA4L antibody (ARP53693_P050)

Click here to view the HSPA4L antibody Western Blot Protocol

Product Datasheet Link: HSPA4L antibody (ARP53693_P050)

WB Suggested Anti-HSPA4L Antibody Titration: 0.2-1 ug/ml
Positive Control: Fetal Brain

Western Blot image:

Description of Target: HSPA4L belongs to the heat shock protein 70 family. HSPA4L possesses chaperone activity in vitro where it inhibits aggregation of citrate synthase.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s HSPA4L antibody (ARP53693_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question