website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

HSPA4L antibody - C-terminal region (ARP53693_P050)

Description of Target:
HSPA4L belongs to the heat shock protein 70 family. HSPA4L possesses chaperone activity in vitro where it inhibits aggregation of citrate synthase.
Gene Symbol:
HSPA4L
Official Gene Full Name:
Heat shock 70kDa protein 4-like
NCBI Gene Id:
22824
Alias Symbols:
APG-1; Osp94; HSPH3
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HSPA4L.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HSPA4L.
Swissprot Id:
O95757
Protein Accession #:
NP_055093
Nucleotide Accession #:
NM_014278
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Heat shock 70 kDa protein 4L
Protein Size (# AA):
839
Molecular Weight:
92kDa
Application:
WB
Protein Interactions:
SUMO2; STUB1; TTC1; SGTA; HSPA8; HSF1; UBC; IPO7; SEC23A; RANBP3; STAT1; PPP2R2A; GARS; APEH; PUS7; LUC7L2; METTL21A; PAXIP1; DIAPH1; NUP188; NUBP2; VPS26A; TERF2; PHLDA1; TUSC2; TCEAL1; DOK2; USF2; KRT8;
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human HSPA4L
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-HSPA4L (ARP53693_P050)
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 80%
Species Reactivity:
Cow; Dog; Guinea Pig; Horse; Human; Mouse; Rabbit; Rat; Zebrafish
Datasheets / Downloads:
Printable datasheet for anti-HSPA4L (ARP53693_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI
Blocking Peptide:
For anti-HSPA4L (ARP53693_P050) antibody is Catalog # AAP53693 (Previous Catalog # AAPP30535)
Target Reference:
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: HSPA4L antibody tested with Human Fetal Brain Tissue (ARP53693_P050)

Aviva Systems Biology is the original manufacturer of this HSPA4L antibody (ARP53693_P050)

Click here to view the HSPA4L antibody Western Blot Protocol

Product Datasheet Link: HSPA4L antibody (ARP53693_P050)

WB Suggested Anti-HSPA4L Antibody Titration: 0.2-1 ug/ml
Positive Control: Fetal Brain

Western Blot image:


Description of Target: HSPA4L belongs to the heat shock protein 70 family. HSPA4L possesses chaperone activity in vitro where it inhibits aggregation of citrate synthase.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s HSPA4L antibody (ARP53693_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question