website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

HSPA4L antibody - C-terminal region (ARP53693_P050)

Description of Target:
HSPA4L belongs to the heat shock protein 70 family. HSPA4L possesses chaperone activity in vitro where it inhibits aggregation of citrate synthase.
Gene Symbol:
HSPA4L
Official Gene Full Name:
Heat shock 70kDa protein 4-like
NCBI Gene Id:
22824
Alias Symbols:
APG-1; Osp94; HSPH3
Tissue Tool:
Find tissues and cell lines supported to express HSPA4L.
Protein Accession #:
NP_055093
Nucleotide Accession#:
NM_014278
Swissprot Id:
O95757
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Heat shock 70 kDa protein 4L
Protein Size (# AA):
839
Molecular Weight:
92kDa
Application:
WB
Partner Proteins:
SCFD1
Immunogen:
The immunogen for anti-HSPA4L antibody: synthetic peptide directed towards the C terminal of human HSPA4L
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
HSPA4L antibody - C-terminal region (ARP53693_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Zebrafish: 80%
Species Reactivity:
Human, Rat, Bovine, Pig, Horse, Rabbit, Guinea pig, Mouse, Dog, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-HSPA4L antibody
- ARP53693_P050
Peptide Sequence:
Synthetic peptide located within the following region: KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI
Blocking Peptide:
For anti-HSPA4L antibody is Catalog # AAP53693 (Previous Catalog # AAPP30535)
Key Reference:
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-HSPA4L antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question