Catalog No: P100979_P050
Price: $0.00
SKU
P100979_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-HSF2 (P100979_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human HSF2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Guinea Pig: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: SSVQMNPTDYINNTKSENKGLETTKNNVVQPVSEEGRKSKSKPDKQLIQY
Concentration0.5 mg/ml
Blocking PeptideFor anti-HSF2 (P100979_P050) antibody is Catalog # AAP31098 (Previous Catalog # AAPP01837)
Sample Type Confirmation

HSF2 is supported by BioGPS gene expression data to be expressed in 721_B

ReferenceZhang,J., (2008) J. Biol. Chem. 283 (12), 7464-7469
Description
Gene SymbolHSF2
Gene Full NameHeat shock transcription factor 2
Alias SymbolsHSF 2, HSTF 2
NCBI Gene Id3298
Protein NameHeat shock factor protein 2
Description of TargetHSF2 binds specifically to the heat-shock element and has homology to HSFs of other species. Heat shock transcription factors activate heat-shock response genes under conditions of heat or other stresses. Although the names HSF1 and HSF2 were chosen for historical reasons, these peptides should be referred to as heat-shock transcription factors.HSF2, as well as the related gene HSF1, encodes a protein that binds specifically to the heat-shock element and has homology to HSFs of other species. Heat shock transcription factors activate heat-shock response genes under conditions of heat or other stresses. Although the names HSF1 and HSF2 were chosen for historical reasons, these peptides should be referred to as heat-shock transcription factors. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ03933
Protein Accession #NP_004497
Nucleotide Accession #NM_004506
Protein Size (# AA)536
Molecular Weight60kDa
Protein InteractionsNUP62; MTUS2; WDR5; TPM3; SUMO2; HSF4; HSF1; UBC; PCGF2; SUMO1; UBE2I; Zwint; FZR1; CUL3; CDC27; CDC20; PPP2R1A; NCAPG; HSF2BP; SUMO3; HSPA1A;
  1. What is the species homology for "HSF2 Antibody - middle region (P100979_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Guinea Pig, Rabbit".

  2. How long will it take to receive "HSF2 Antibody - middle region (P100979_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HSF2 Antibody - middle region (P100979_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HSF2 Antibody - middle region (P100979_P050)"?

    This target may also be called "HSF 2, HSTF 2" in publications.

  5. What is the shipping cost for "HSF2 Antibody - middle region (P100979_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HSF2 Antibody - middle region (P100979_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HSF2 Antibody - middle region (P100979_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "60kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HSF2 Antibody - middle region (P100979_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HSF2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HSF2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HSF2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HSF2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HSF2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HSF2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HSF2 Antibody - middle region (P100979_P050)
Your Rating
We found other products you might like!