Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP41821_P050
Price: $0.00
SKU
ARP41821_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-HSD3B1 (ARP41821_P050) antibody
Product Info
Tested Species ReactivityHuman, Monkey
Predicted Species ReactivityHuman, Goat, Monkey
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HSD3B1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceGoat: 82%; Human: 100%; Monkey: 92%
Peptide SequenceSynthetic peptide located within the following region: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-HSD3B1 (ARP41821_P050) antibody is Catalog # AAP41821 (Previous Catalog # AAPP10869)
ReferenceRoss,R.W., (2008) J. Clin. Oncol. 26 (6), 842-847
Publications

Dual targeting of androgen receptor and mTORC1 by salinomycin in prostate cancer. Oncotarget. 7, 62240-62254 (2016). 27557496

Gene SymbolHSD3B1
Gene Full NameHydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1
Alias SymbolsHSD3B, HSDB3, HSDB3A, SDR11E1, 3BETAHSD
NCBI Gene Id3283
Protein Name3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1
Description of Target3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.
Uniprot IDP14060
Protein Accession #NP_000853
Nucleotide Accession #NM_000862
Protein Size (# AA)373
Molecular Weight42kDa
  1. What is the species homology for "HSD3B1 Antibody - N-terminal region (ARP41821_P050)"?

    The tested species reactivity for this item is "Human, Monkey". This antibody is predicted to have homology to "Human, Goat, Monkey".

  2. How long will it take to receive "HSD3B1 Antibody - N-terminal region (ARP41821_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HSD3B1 Antibody - N-terminal region (ARP41821_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HSD3B1 Antibody - N-terminal region (ARP41821_P050)"?

    This target may also be called "HSD3B, HSDB3, HSDB3A, SDR11E1, 3BETAHSD" in publications.

  5. What is the shipping cost for "HSD3B1 Antibody - N-terminal region (ARP41821_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HSD3B1 Antibody - N-terminal region (ARP41821_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HSD3B1 Antibody - N-terminal region (ARP41821_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HSD3B1 Antibody - N-terminal region (ARP41821_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HSD3B1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HSD3B1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HSD3B1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HSD3B1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HSD3B1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HSD3B1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HSD3B1 Antibody - N-terminal region (ARP41821_P050)
Your Rating
We found other products you might like!