Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any help please email info@avivasysbio.com

Catalog No: ARP31966_P050
Price: $0.00
SKU
ARP31966_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-HOXD11 (ARP31966_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Cow, Dog, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human HOXD11
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 83%; Dog: 92%; Human: 100%; Mouse: 85%; Rabbit: 85%; Sheep: 83%
Peptide SequenceSynthetic peptide located within the following region: GFDQFYEAAPGPPFAGPQPPPPPAPPQPEGAADKGDPRTGAGGGGGSPCT
Concentration0.5 mg/ml
Blocking PeptideFor anti-HOXD11 (ARP31966_P050) antibody is Catalog # AAP31966 (Previous Catalog # AAPP02989)
ReferenceWeterman,M.A., (2002) Am. J. Med. Genet. 112 (3), 256-265
Gene SymbolHOXD11
Gene Full NameHomeobox D11
Alias SymbolsHOX4, HOX4F
NCBI Gene Id3237
Protein NameHomeobox protein Hox-D11
Description of TargetHOXD11 belongs to the homeobox family. This family play an important role in morphogenesis in all multicellular organisms. The mouse Hoxd11 plays a role in forelimb morphogenesis.This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. The product of the mouse Hoxd11 gene plays a role in forelimb morphogenesis.
Uniprot IDA6NIS4
Protein Accession #NP_067015
Nucleotide Accession #NM_021192
Protein Size (# AA)338
Molecular Weight35kDa
Protein InteractionsMEIS1; HMGB1;
  1. What is the species homology for "HOXD11 Antibody - middle region (ARP31966_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Cow, Dog, Rabbit, Sheep".

  2. How long will it take to receive "HOXD11 Antibody - middle region (ARP31966_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HOXD11 Antibody - middle region (ARP31966_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HOXD11 Antibody - middle region (ARP31966_P050)"?

    This target may also be called "HOX4, HOX4F" in publications.

  5. What is the shipping cost for "HOXD11 Antibody - middle region (ARP31966_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HOXD11 Antibody - middle region (ARP31966_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HOXD11 Antibody - middle region (ARP31966_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HOXD11 Antibody - middle region (ARP31966_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HOXD11"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HOXD11"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HOXD11"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HOXD11"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HOXD11"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HOXD11"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HOXD11 Antibody - middle region (ARP31966_P050)
Your Rating