SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP40721_T100
Price: $0.00
SKU
ARP40721_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-HNRNPH3 (ARP40721_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HNRPH3
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: DYQGRSTGEAFVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFY
Concentration1.0 mg/ml
Blocking PeptideFor anti-HNRNPH3 (ARP40721_T100) antibody is Catalog # AAP40721 (Previous Catalog # AAPY00973)
Sample Type Confirmation

HNRNPH3 is strongly supported by BioGPS gene expression data to be expressed in Raji

Enhanced Validation
Relative Expression (Western Blot) Avivasheild
ReferenceAndersen,J.S., (2002) Curr. Biol. 12 (1), 1-11
Publications

Larriba, M. J. et al. Novel snail1 target proteins in human colon cancer identified by proteomic analysis. PLoS One 5, e10221 (2010). 20421926

Gene SymbolHNRNPH3
Gene Full NameHeterogeneous nuclear ribonucleoprotein H3 (2H9)
Alias Symbols2H9, HNRPH3
NCBI Gene Id3189
Protein NameHeterogeneous nuclear ribonucleoprotein H3
Description of TargetHNRPH3 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein has two repeats of quasi-RRM domains that bind to RNAs. It is localized in nuclear bodies of the nucleus. This protein is involved in the splicing process and it also participates in early heat shock-induced splicing arrest by transiently leaving the hnRNP complexes.This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It is localized in nuclear bodies of the nucleus. This protein is involved in the splicing process and it also participates in early heat shock-induced splicing arrest by transiently leaving the hnRNP complexes. Multiple alternative transcript variants seem to be present for this gene and some appear to have intronic regions in the mRNA. Presently, only two transcript variants are fully described.
Uniprot IDP31942
Protein Accession #NP_036339
Nucleotide Accession #NM_012207
Protein Size (# AA)346
Molecular Weight38 kDa
Protein InteractionsUBC; SUMO2; SUMO3; STAU1; SUMO1; NEDD8; WWOX; ERG; RNF2; EED; rev; PARK2; STK24; HNRNPH3; HNRNPH1; HNRNPF; HNRNPD; HNRNPA1; FN1; DDX5; ITGA4; IL7R; HNRNPU; C17orf85; tat; HCVgp1; HNRNPUL1; HNRNPA0; CHERP; DDX17; VCAM1; RBM4; VCP; PUF60; SF3A3; HNRNPR; HNR
  1. What is the species homology for "HNRPH3 Antibody - N-terminal region (ARP40721_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "HNRPH3 Antibody - N-terminal region (ARP40721_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HNRPH3 Antibody - N-terminal region (ARP40721_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HNRPH3 Antibody - N-terminal region (ARP40721_T100)"?

    This target may also be called "2H9, HNRPH3" in publications.

  5. What is the shipping cost for "HNRPH3 Antibody - N-terminal region (ARP40721_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HNRPH3 Antibody - N-terminal region (ARP40721_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HNRPH3 Antibody - N-terminal region (ARP40721_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "38 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HNRPH3 Antibody - N-terminal region (ARP40721_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HNRNPH3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HNRNPH3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HNRNPH3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HNRNPH3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HNRNPH3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HNRNPH3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HNRPH3 Antibody - N-terminal region (ARP40721_T100)
Your Rating