website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

HMOX1 Antibody - N-terminal region (ARP45222_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Heme oxygenase (decycling) 1
Protein Name:
Heme oxygenase 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
HO-1, HSP32, bK286B10
Description of Target:
HMOX1 belongs to the heme oxygenase family. Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HMOX1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HMOX1.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human HMOX1
Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-HMOX1 (ARP45222_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVM
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HMOX1 (ARP45222_P050) antibody is Catalog # AAP45222
Datasheets / Downloads:
Printable datasheet for anti-HMOX1 (ARP45222_P050) antibody

Kawahara, G. et al. Dystrophic muscle improvement in zebrafish via increased heme oxygenase signaling. Hum. Mol. Genet. 23, 1869-78 (2014). WB, Human, Dog, Goat, Rabbit, Mouse, Pig, Rat, Bovine, Guinea pig 24234649

Product Protocols: HMOX1 antibody tested with Human Hepg2 Cells (ARP45222_P050)

Aviva Systems Biology is the original manufacturer of this HMOX1 antibody (ARP45222_P050)

Click here to view the HMOX1 antibody Western Blot Protocol

Product Datasheet Link: HMOX1 antibody (ARP45222_P050)

WB Suggested Anti-HMOX1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2

Western Blot image:

Description of Target: HMOX1 belongs to the heme oxygenase family. Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2.Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s HMOX1 antibody (ARP45222_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Review: HMOX1 antibody - N-terminal region (ARP45222_P050) in Human and Mouse tonsil using Western Blot

Product Page Link: HMOX1 antibody - N-terminal region (ARP45222_P050)

Data Provided by Dr. Frank Wagener of Radboud University, Netherlands

Tonsil Extract:

Took right side tonsil (19-04-2011 Corien) from -80 dC vial storage system. Cut off a piece of tonsil of about 3x3x3 mm and added 200ul Odyssey Lysis buffer (0.5% Triton X-100 + 1mM EDTA + 1mM PMSF + Protease Inhibitor Cocktail). Homogenized tonsil using an Eppendorf Micropestle and incubated on ice for about 30 minutes (vortexing every 10 minutes). Centrifuged full speed at 4 dC for 2 minutes and took supernatant. Measured protein concentration using the Nanodrop (BSA method) -->18.7mg/ml. Added to 300ul supernatant 100ul 4 x sample buffer and heated at 95 dC for 5 minutes -->14ug/ul. Stored tonsil extract in -80 dC vial storage system (vial drawer 4 box 1).

Western Blot


HMOX-1 (Aviva): rabbit --> block 5% ELK (1h RT), 1st ab 1:3000 2.5% ELK + 0.1% Tween (O/N 4C), 2nd ab (680) 1:10000 2.5% ELK +0.1% Tween + 0.01% SDS (45 min RT).

Anti-Beta Actin (Sigma):, mouse --> block 5% ELK (1h RT) 1st ab 1:100000 2.5% ELK + 0.1% Tween (O/N 4C), 2nd ab (800) 1:10000 2.5% ELK + 0.1% Tween + 0.01% SDS (45min RT).

Used a 1:3000 dilution because only very little antibody was left (recommended dilution is 1:1000).

Ask a Question