website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

HMOX1 Antibody - N-terminal region (ARP45222_P050)

Description of Target:
HMOX1 belongs to the heme oxygenase family. Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2.
Gene Symbol:
Official Gene Full Name:
Heme oxygenase (decycling) 1
NCBI Gene Id:
Alias Symbols:
HO-1; HSP32; bK286B10
Tissue Tool:
Find tissues and cell lines supported to express HMOX1.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Heme oxygenase 1
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for Anti-HMOX1 antibody is: synthetic peptide directed towards the N-terminal region of Human HMOX1
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
HMOX1 antibody - N-terminal region (ARP45222_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%
Species Reactivity:
Human, Dog, Goat, Rabbit, Mouse, Pig, Rat, Bovine, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-HMOX1 antibody
Peptide Sequence:
Synthetic peptide located within the following region: ERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVM
Blocking Peptide:
For anti-HMOX1 antibody is Catalog # AAP45222
Key Reference:
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-HMOX1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question