website statistics
Account Login 

Aviva Systems Biology office will be closed for Christmas and New Year holidays - 12/24/2014, 12/25/2014 and 1/1/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

HMOX1 Antibody - N-terminal region (ARP45222_P050)

Description of Target:
HMOX1 belongs to the heme oxygenase family. Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2.
Gene Symbol:
Official Gene Full Name:
Heme oxygenase (decycling) 1
NCBI Gene Id:
Alias Symbols:
HO-1; HSP32; bK286B10
Tissue Tool:
Find tissues and cell lines supported to express HMOX1.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Heme oxygenase 1
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for Anti-HMOX1 antibody is: synthetic peptide directed towards the N-terminal region of Human HMOX1
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
HMOX1 antibody - N-terminal region (ARP45222_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%
Species Reactivity:
Human, Dog, Goat, Rabbit, Mouse, Pig, Rat, Bovine, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-HMOX1 antibody
Peptide Sequence:
Synthetic peptide located within the following region: ERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVM
Blocking Peptide:
For anti-HMOX1 antibody is Catalog # AAP45222
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-HMOX1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for HMOX1 antibody (ARP45222)

Product page for HMOX1 antibody (ARP45222)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog hmox1 antibody; Xenopus laevis hmox1 antibody Q2VPG8 92%
African clawed frog MGC68771 antibody; Xenopus laevis MGC68771 antibody Q6PA67 91%
African elephant LOC100673521 antibody; Loxodonta africana LOC100673521 antibody G3UAU1 100%
Bovine HMOX1 antibody; Bos taurus HMOX1 antibody Q5E9F2 100%
Chicken HMOX1 antibody; Gallus gallus HMOX1 antibody P14791 92%
Chicken HMOX1 antibody; Gallus gallus HMOX1 antibody Q6LC15 92%
Chicken HMOX1 antibody; Gallus gallus HMOX1 antibody F1NQF4 92%
Chicken HMOX1 antibody; Gallus gallus HMOX1 antibody F1NC96 92%
Chicken hmox1 antibody; Gallus gallus hmox1 antibody E0A2T5 92%
Chinese hamster LOC100756872 antibody; Cricetulus griseus LOC100756872 antibody G3IAI6 92%
Common turkey HMOX1 antibody; Meleagris gallopavo HMOX1 antibody G1NJD4 92%
Dog Cfa.4568 antibody; Canis familiaris Cfa.4568 antibody F1P8U7 100%
Duckbill platypus HMOX1 antibody; Ornithorhynchus anatinus HMOX1 antibody F7AF62 100%
Gray short-tailed opossum LOC100024355 antibody; Monodelphis domestica LOC100024355 antibody F7CK49 100%
Green anole CCDC138 antibody; Anolis carolinensis CCDC138 antibody G1KA69 84%
Green anole HMOX1 antibody; Anolis carolinensis HMOX1 antibody G1KVH7 91%
Green anole HMOX1 antibody; Anolis carolinensis HMOX1 antibody G1KSW4 91%
Guinea pig HMOX1 antibody; Cavia porcellus HMOX1 antibody H0WA81 92%
Human HMOX1 antibody; Homo sapiens HMOX1 antibody P09601 100%
Human HMOX1 antibody; Homo sapiens HMOX1 antibody Q96DI8 100%
Human HMOX1 antibody; Homo sapiens HMOX1 antibody Q6FH11 100%
Human HMOX1 antibody; Homo sapiens HMOX1 antibody F2YMD9 100%
Human HMOX1 antibody; Homo sapiens HMOX1 antibody D2K7W4 100%
Human HMOX1 antibody; Homo sapiens HMOX1 antibody B1AHA8 100%
Little brown bat HMOX1 antibody; Myotis lucifugus HMOX1 antibody G1PC93 100%
Lowland gorilla HMOX1 antibody; Gorilla gorilla gorilla HMOX1 antibody G3R2I0 100%
Mouse HMOX1 antibody; Mus musculus HMOX1 antibody P14901 100%
Mouse Hmox1 antibody; Mus musculus Hmox1 antibody Q3U5U6 100%
Mouse Hmox1 antibody; Mus musculus Hmox1 antibody Q3U5H8 100%
Mouse Hmox1 antibody; Mus musculus Hmox1 antibody Q3TVV4 100%
Mouse Hmox1 antibody; Mus musculus Hmox1 antibody E9Q8W7 100%
Northern white-cheeked gibbon LOC100587046 antibody; Nomascus leucogenys LOC100587046 antibody G1RW01 100%
Pig HMOX1 antibody; Sus scrofa HMOX1 antibody P32394 100%
Rabbit HO1 antibody; Oryctolagus cuniculus HO1 antibody G1SZP6 100%
Rat HMOX1 antibody; Rattus norvegicus HMOX1 antibody P06762 100%
Rat Hmox1 antibody; Rattus norvegicus Hmox1 antibody D3ZNY2 100%
Rhesus macaque HMOX1 antibody; Macaca mulatta HMOX1 antibody F6QK66 100%
Rhesus macaque Mmu.10024 antibody; Macaca mulatta Mmu.10024 antibody F7EK58 100%
Small-eared galago HMOX1 antibody; Otolemur garnettii HMOX1 antibody H0XB70 92%
Sumatran orangutan HMOX1 antibody; Pongo abelii HMOX1 antibody Q5R7E3 100%
Tasmanian devil HMOX1 antibody; Sarcophilus harrisii HMOX1 antibody G3X3T7 100%
Western clawed frog hmox1 antibody; Xenopus tropicalis hmox1 antibody F6U7V2 100%
White-tufted-ear marmoset LOC100414343 antibody; Callithrix jacchus LOC100414343 antibody F6U6L9 100%
Zebra finch Tgu.2990 antibody; Taeniopygia guttata Tgu.2990 antibody H0ZKQ8 91%

Product Protocols: HMOX1 antibody tested with Human Hepg2 Cells (ARP45222_P050)

Aviva Systems Biology is the original manufacturer of this HMOX1 antibody (ARP45222_P050)

Click here to view the HMOX1 antibody Western Blot Protocol

Product Datasheet Link: HMOX1 antibody (ARP45222_P050)

WB Suggested Anti-HMOX1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2

Western Blot image:

Description of Target: HMOX1 belongs to the heme oxygenase family. Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2.Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s HMOX1 antibody (ARP45222_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Review: HMOX1 antibody - N-terminal region (ARP45222_P050) in Human and Mouse tonsil using Western Blot

Product Page Link: HMOX1 antibody - N-terminal region (ARP45222_P050)

Data Provided by Dr. Frank Wagener of Radboud University, Netherlands

Tonsil Extract:

Took right side tonsil (19-04-2011 Corien) from -80 dC vial storage system. Cut off a piece of tonsil of about 3x3x3 mm and added 200ul Odyssey Lysis buffer (0.5% Triton X-100 + 1mM EDTA + 1mM PMSF + Protease Inhibitor Cocktail). Homogenized tonsil using an Eppendorf Micropestle and incubated on ice for about 30 minutes (vortexing every 10 minutes). Centrifuged full speed at 4 dC for 2 minutes and took supernatant. Measured protein concentration using the Nanodrop (BSA method) -->18.7mg/ml. Added to 300ul supernatant 100ul 4 x sample buffer and heated at 95 dC for 5 minutes -->14ug/ul. Stored tonsil extract in -80 dC vial storage system (vial drawer 4 box 1).

Western Blot


HMOX-1 (Aviva): rabbit --> block 5% ELK (1h RT), 1st ab 1:3000 2.5% ELK + 0.1% Tween (O/N 4C), 2nd ab (680) 1:10000 2.5% ELK +0.1% Tween + 0.01% SDS (45 min RT).

Anti-Beta Actin (Sigma):, mouse --> block 5% ELK (1h RT) 1st ab 1:100000 2.5% ELK + 0.1% Tween (O/N 4C), 2nd ab (800) 1:10000 2.5% ELK + 0.1% Tween + 0.01% SDS (45min RT).

Used a 1:3000 dilution because only very little antibody was left (recommended dilution is 1:1000).

Ask a Question