website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

HMOX1 Antibody - N-terminal region (ARP45222_P050)

Description of Target:
HMOX1 belongs to the heme oxygenase family. Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2.
Gene Symbol:
HMOX1
Official Gene Full Name:
Heme oxygenase (decycling) 1
NCBI Gene Id:
3162
Alias Symbols:
HO-1; HSP32; bK286B10
Tissue Tool:
Find tissues and cell lines supported to express HMOX1.
Protein Accession #:
NP_002124
Nucleotide Accession#:
NM_002133
Swissprot Id:
P09601
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Heme oxygenase 1
Protein Size (# AA):
288
Molecular Weight:
33kDa
Application:
WB
Partner Proteins:
AKT1,BLVRB,HMOX1,NOS1,POR,ELAVL1,HMOX1,HMX1,POT1,PSMD2,TERF1,UBC,UFD1L
Immunogen:
The immunogen for Anti-HMOX1 antibody is: synthetic peptide directed towards the N-terminal region of Human HMOX1
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
HMOX1 antibody - N-terminal region (ARP45222_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%
Species Reactivity:
Human, Dog, Goat, Rabbit, Mouse, Pig, Rat, Bovine, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-HMOX1 antibody
ARP45222_P050
Peptide Sequence:
Synthetic peptide located within the following region: ERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVM
Blocking Peptide:
For anti-HMOX1 antibody is Catalog # AAP45222
Key Reference:
N/A
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-HMOX1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question