HMBOX1 Antibody - N-terminal region (ARP39599_T100)

Catalog No: ARP39599_T100

WB Suggested Anti-HMBOX1 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

Host: Mouse
Target Name: HMBOX1
Sample Tissue: Mouse Brain
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HMBOX1
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
• Peptide Sequence: Synthetic peptide located within the following region: ETMSHYTDEPRFTIEQIDLLQRLRRTGMTKHEILHALETLDRLDQEHSDK
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-HMBOX1 (ARP39599_T100) antibody is Catalog # AAP39599 (Previous Catalog # AAPP21619)
• Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Target Info

• Gene Symbol: HMBOX1
• Gene Full Name: Homeobox containing 1
• Alias Symbols: HOT1, TAH1, PBHNF, HNF1LA
• NCBI Gene Id: 79618
• Protein Name: Homeobox-containing protein 1
• Description of Target: HMBOX1 is located at the boundary of 8p12.3 and 8p21.1. HMBOX1 proteins are highly conserved in human, mouse, rat, chicken and Xenopus laevis. Functional HMBOX1::EGFP (enhanced green fluorescent protein) fusion protein revealed that HMBOX1 accumulated more in cytoplasm than in nucleus. HMBOX1 is a transcription repressor. Human HMBOX1 is widely expressed in 18 tissues, and it is highly expressed in pancreas. Hmbox1 is widely expressed in mouse pancreas and the expression of this gene can also be detected in pallium, hippocampus and hypothalamus.
• Uniprot ID: Q6NT76
• Protein Accession #: NP_078843
• Nucleotide Accession #: NM_024567
• Protein Size (# AA): 420
• Molecular Weight: 47kDa
• Protein Interactions: FAM74A4; PKD1P1; FAM13C; TCEANC; RBMY2FP; ZMAT2; ZNF417; DYNLL2; ASB7; FRMD6; AEBP2; SFR1; REEP6; ZNF587; LNX1; FAM161A; SAP30L; HMBOX1; C20orf195; C8orf33; UBE2Z; MRPL11; CARD9; SH2D4A; CBX8; UBA6; FAM206A; ZNF581; MAGEH1; ZNF337; MORF4L1; FARS2; MRPL28;