website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

HIBADH antibody - middle region (ARP53112_P050)

  • Catalog#: ARP53112_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Free trial-size samples may be available for this item. Please go here for more information.
Print Page
100 ul
    In Stock
    Free trial-size samples may be available for this item. Please go here for more information.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    3-hydroxyisobutyrate dehydrogenase
    Protein Name:
    3-hydroxyisobutyrate dehydrogenase, mitochondrial
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    MGC40361, NS5ATP1
    Replacement Item:
    This antibody may replace item sc-243020 from Santa Cruz Biotechnology.
    Description of Target:
    3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-557 BQ051350.1 1-557 558-1832 BC020167.1 437-1711 1833-1970 BC013855.1 1224-1361 1971-1994 BC020167.1 1850-1873 1995-2006 BC013855.1 1386-1397
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express HIBADH.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express HIBADH.
    The immunogen is a synthetic peptide directed towards the middle region of human HIBADH
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
    Complete computational species homology data:
    Anti-HIBADH (ARP53112_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: WSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPIL
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    Blocking Peptide:
    For anti-HIBADH (ARP53112_P050) antibody is Catalog # AAP53112 (Previous Catalog # AAPP34421)
    Datasheets / Downloads:
    Printable datasheet for anti-HIBADH (ARP53112_P050) antibody
    Target Reference:
    Hughes,G.J., (1993) Electrophoresis 14 (11), 1216-1222

    Product Protocols: HIBADH antibody tested with Human Fetal Liver Tissue (ARP53112_P050)

    Aviva Systems Biology is the original manufacturer of this HIBADH antibody (ARP53112_P050)

    Click here to view the HIBADH antibody Western Blot Protocol

    Product Datasheet Link: HIBADH antibody (ARP53112_P050)

    WB Suggested Anti-HIBADH Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:312500
    Positive Control: Fetal Liver

    Western Blot image:

    Description of Target: 3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-557 BQ051350.1 1-557 558-1832 BC020167.1 437-1711 1833-1970 BC013855.1 1224-1361 1971-1994 BC020167.1 1850-1873 1995-2006 BC013855.1 1386-1397

    Questions pertaining to this data can be directed to

    Aviva Systems Biology’s HIBADH antibody (ARP53112_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

    Ask a Question