website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

HIBADH antibody - middle region (ARP53112_P050)

Description of Target:
3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-557 BQ051350.1 1-557 558-1832 BC020167.1 437-1711 1833-1970 BC013855.1 1224-1361 1971-1994 BC020167.1 1850-1873 1995-2006 BC013855.1 1386-1397
Gene Symbol:
HIBADH
Official Gene Full Name:
3-hydroxyisobutyrate dehydrogenase
NCBI Gene Id:
11112
Alias Symbols:
MGC40361; NS5ATP1
Tissue Tool:
Find tissues and cell lines supported to express HIBADH.
Protein Accession #:
NP_689953
Nucleotide Accession#:
NM_152740
Swissprot Id:
P31937
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
3-hydroxyisobutyrate dehydrogenase, mitochondrial
Protein Size (# AA):
336
Molecular Weight:
35kDa
Application:
WB
Immunogen:
The immunogen for anti-HIBADH antibody: synthetic peptide directed towards the middle region of human HIBADH
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
HIBADH antibody - middle region (ARP53112_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Species Reactivity:
Mouse, Horse, Dog, Pig, Rabbit, Rat, Guinea pig, Human, Bovine, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-HIBADH antibody
- ARP53112_P050
Peptide Sequence:
Synthetic peptide located within the following region: WSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPIL
Blocking Peptide:
For anti-HIBADH antibody is Catalog # AAP53112 (Previous Catalog # AAPP34421)
Target Reference:
Hughes,G.J., (1993) Electrophoresis 14 (11), 1216-1222
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-HIBADH antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for HIBADH antibody (ARP53112)

Product page for HIBADH antibody (ARP53112)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog hibadh antibody; Xenopus laevis hibadh antibody Q6NRB2 92%
African clawed frog LOC495134 antibody; Xenopus laevis LOC495134 antibody Q5XGV0 92%
African elephant HIBADH antibody; Loxodonta africana HIBADH antibody G3TBQ0 92%
Atlantic salmon 3HIDH antibody; Salmo salar 3HIDH antibody B5X3N8 78%
Bovine 3HIDH antibody; Bos taurus 3HIDH antibody Q2HJD7 100%
Burton mouthbrooder hibadha antibody; Haplochromis burtoni hibadha antibody A8DSY0 78%
Burton mouthbrooder hibadhb antibody; Haplochromis burtoni hibadhb antibody A8DSV9 78%
Chicken HIBADH antibody; Gallus gallus HIBADH antibody Q5ZLI9 85%
Common turkey HIBADH antibody; Meleagris gallopavo HIBADH antibody G1NE12 85%
Dog HIBADH antibody; Canis familiaris HIBADH antibody F1PYB6 100%
Duckbill platypus HIBADH antibody; Ornithorhynchus anatinus HIBADH antibody F7DAN7 92%
Duckbill platypus HIBADH antibody; Ornithorhynchus anatinus HIBADH antibody F7DAN0 92%
Golden hamster 3HIDH antibody; Mesocricetus auratus 3HIDH antibody P86199 100%
Gray short-tailed opossum LOC100010435 antibody; Monodelphis domestica LOC100010435 antibody F6RV12 92%
Greater horseshoe bat MGC128999 antibody; Rhinolophus ferrumequinum MGC128999 antibody B2KIN3 100%
Guinea pig HIBADH antibody; Cavia porcellus HIBADH antibody H0W439 100%
Horse HIBADH antibody; Equus caballus HIBADH antibody F6XXT9 100%
Human 3HIDH antibody; Homo sapiens 3HIDH antibody P31937 100%
Human HIBADH antibody; Homo sapiens HIBADH antibody Q546Z2 100%
Japanese pufferfish Hibadha antibody; Takifugu rubripes Hibadha antibody Q1KL24 78%
Japanese pufferfish Hibadhb antibody; Takifugu rubripes Hibadhb antibody Q1KKZ7 78%
Little brown bat HIBADH antibody; Myotis lucifugus HIBADH antibody G1PB98 92%
Lowland gorilla HIBADH antibody; Gorilla gorilla gorilla HIBADH antibody G3RBS7 100%
Mouse 3HIDH antibody; Mus musculus 3HIDH antibody Q99L13 100%
Mouse Hibadh antibody; Mus musculus Hibadh antibody E9Q155 100%
Mouse Hibadh antibody; Mus musculus Hibadh antibody A0ZNJ2 100%
Northern white-cheeked gibbon HIBADH antibody; Nomascus leucogenys HIBADH antibody G1RYC1 100%
Pig HIBADH antibody; Sus scrofa HIBADH antibody F1SHU0 100%
Rabbit LOC100343653 antibody; Oryctolagus cuniculus LOC100343653 antibody G1SZ37 100%
Rat 3HIDH antibody; Rattus norvegicus 3HIDH antibody P29266 100%
Rhesus macaque HIBADH antibody; Macaca mulatta HIBADH antibody F7DFR4 100%
Rhesus macaque HIBADH antibody; Macaca mulatta HIBADH antibody F6W2R9 100%
Small-eared galago HIBADH antibody; Otolemur garnettii HIBADH antibody H0WGE1 100%
Sumatran orangutan 3HIDH antibody; Pongo abelii 3HIDH antibody Q5R5E7 100%
Sumatran orangutan DKFZP469F1932 antibody; Pongo abelii DKFZP469F1932 antibody Q5RF30 100%
Tasmanian devil HIBADH antibody; Sarcophilus harrisii HIBADH antibody G3WS52 100%
Three-spined stickleback HIBADH (1 of 2) antibody; Gasterosteus aculeatus HIBADH (1 of 2) antibody G3NVX5 78%
Three-spined stickleback HIBADH (2 of 2) antibody; Gasterosteus aculeatus HIBADH (2 of 2) antibody G3P038 78%
Western clawed frog hibadh antibody; Xenopus tropicalis hibadh antibody Q5BKJ0 92%
Western clawed frog hibadh antibody; Xenopus tropicalis hibadh antibody F6R371 92%
White-tufted-ear marmoset LOC100395488 antibody; Callithrix jacchus LOC100395488 antibody F7HAF5 100%
White-tufted-ear marmoset LOC100395488 antibody; Callithrix jacchus LOC100395488 antibody F6R6Q0 100%
White-tufted-ear marmoset LOC100395488 antibody; Callithrix jacchus LOC100395488 antibody F7H5C6 100%
Zebra finch Tgu.8387 antibody; Taeniopygia guttata Tgu.8387 antibody H0YXI9 92%
Zebrafish hibadhb antibody; Danio rerio hibadhb antibody Q7SXJ4 85%
Zebrafish hibadhb antibody; Danio rerio hibadhb antibody F1QE62 85%

Product Protocols: HIBADH antibody tested with Human Fetal Liver Tissue (ARP53112_P050)

Aviva Systems Biology is the original manufacturer of this HIBADH antibody (ARP53112_P050)

Click here to view the HIBADH antibody Western Blot Protocol

Product Datasheet Link: HIBADH antibody (ARP53112_P050)

WB Suggested Anti-HIBADH Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal Liver

Western Blot image:


Description of Target: 3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-557 BQ051350.1 1-557 558-1832 BC020167.1 437-1711 1833-1970 BC013855.1 1224-1361 1971-1994 BC020167.1 1850-1873 1995-2006 BC013855.1 1386-1397

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s HIBADH antibody (ARP53112_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question