website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

HIBADH antibody - middle region (ARP53112_P050)

Description of Target:
3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-557 BQ051350.1 1-557 558-1832 BC020167.1 437-1711 1833-1970 BC013855.1 1224-1361 1971-1994 BC020167.1 1850-1873 1995-2006 BC013855.1 1386-1397
Gene Symbol:
HIBADH
Official Gene Full Name:
3-hydroxyisobutyrate dehydrogenase
NCBI Gene Id:
11112
Alias Symbols:
MGC40361; NS5ATP1
Tissue Tool:
Find tissues and cell lines supported to express HIBADH.
Protein Accession #:
NP_689953
Nucleotide Accession#:
NM_152740
Swissprot Id:
P31937
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
3-hydroxyisobutyrate dehydrogenase, mitochondrial
Protein Size (# AA):
336
Molecular Weight:
35kDa
Application:
WB
Immunogen:
The immunogen for anti-HIBADH antibody: synthetic peptide directed towards the middle region of human HIBADH
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
HIBADH antibody - middle region (ARP53112_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Species Reactivity:
Mouse, Horse, Dog, Pig, Rabbit, Rat, Guinea pig, Human, Bovine, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-HIBADH antibody
- ARP53112_P050
Peptide Sequence:
Synthetic peptide located within the following region: WSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPIL
Blocking Peptide:
For anti-HIBADH antibody is Catalog # AAP53112 (Previous Catalog # AAPP34421)
Key Reference:
Hughes,G.J., (1993) Electrophoresis 14 (11), 1216-1222
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-HIBADH antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question