website statistics
Account Login 

Aviva Systems Biology office will be closed for Independence Day - 7/3/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

HIBADH antibody - middle region (ARP53112_P050)

Description of Target:
3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-557 BQ051350.1 1-557 558-1832 BC020167.1 437-1711 1833-1970 BC013855.1 1224-1361 1971-1994 BC020167.1 1850-1873 1995-2006 BC013855.1 1386-1397
Gene Symbol:
HIBADH
Official Gene Full Name:
3-hydroxyisobutyrate dehydrogenase
NCBI Gene Id:
11112
Alias Symbols:
MGC40361; NS5ATP1
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HIBADH.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HIBADH.
Swissprot Id:
P31937
Protein Accession #:
NP_689953
Nucleotide Accession #:
NM_152740
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
3-hydroxyisobutyrate dehydrogenase, mitochondrial
Protein Size (# AA):
336
Molecular Weight:
35kDa
Application:
WB
Protein Interactions:
BRCA1; ELAVL1; UBC; TRIM63; HIBADH;
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human HIBADH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-HIBADH (ARP53112_P050)
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Species Reactivity:
Cow; Dog; Guinea Pig; Horse; Human; Mouse; Rabbit; Rat; Zebrafish
Datasheets / Downloads:
Printable datasheet for anti-HIBADH (ARP53112_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: WSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPIL
Blocking Peptide:
For anti-HIBADH (ARP53112_P050) antibody is Catalog # AAP53112 (Previous Catalog # AAPP34421)
Target Reference:
Hughes,G.J., (1993) Electrophoresis 14 (11), 1216-1222
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: HIBADH antibody tested with Human Fetal Liver Tissue (ARP53112_P050)

Aviva Systems Biology is the original manufacturer of this HIBADH antibody (ARP53112_P050)

Click here to view the HIBADH antibody Western Blot Protocol

Product Datasheet Link: HIBADH antibody (ARP53112_P050)

WB Suggested Anti-HIBADH Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal Liver

Western Blot image:


Description of Target: 3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-557 BQ051350.1 1-557 558-1832 BC020167.1 437-1711 1833-1970 BC013855.1 1224-1361 1971-1994 BC020167.1 1850-1873 1995-2006 BC013855.1 1386-1397

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s HIBADH antibody (ARP53112_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question