HIBADH antibody - middle region (ARP53112_P050)

Catalog#: ARP53112_P050

• Size: 50ug

Human Liver

• Description of Target: 3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-557 BQ051350.1 1-557 558-1832 BC020167.1 437-1711 1833-1970 BC013855.1 1224-1361 1971-1994 BC020167.1 1850-1873 1995-2006 BC013855.1 1386-1397
• Gene Symbol: HIBADH
• Official Gene Full Name: 3-hydroxyisobutyrate dehydrogenase
• Alias Symbols: MGC40361; NS5ATP1
• Protein Accession#: NP_689953
• Nucleotide Accession#: NM_152740
• Swissprot Id: P31937
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 336
• Molecular Weight: 35kDa
• Application: WB
• Immunogen: The immunogen for anti-HIBADH antibody: synthetic peptide directed towards the middle region of human HIBADH
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; African clawed frog: 92%; Chicken: 85%; Zebrafish: 85%
• Peptide Sequence: Synthetic peptide located within the following region: WSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPIL
• Blocking Peptide: For anti-HIBADH antibody is Catalog # AAP53112 (Previous Catalog # AAPP34421)
• Key Reference: Hughes,G.J., (1993) Electrophoresis 14 (11), 1216-1222
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-HIBADH antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: HIBADH antibody tested with Human Fetal Liver Tissue (ARP53112_P050)

Aviva Systems Biology is the original manufacturer of this HIBADH antibody (ARP53112_P050)

Click here to view the HIBADH antibody Western Blot Protocol

Product Datasheet Link: HIBADH antibody (ARP53112_P050)

WB Suggested Anti-HIBADH Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal Liver

Western Blot image:


Description of Target: 3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-557 BQ051350.1 1-557 558-1832 BC020167.1 437-1711 1833-1970 BC013855.1 1224-1361 1971-1994 BC020167.1 1850-1873 1995-2006 BC013855.1 1386-1397

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s HIBADH antibody (ARP53112_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com