- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for HCK Antibody (Phospho-Tyr410) (OAAF07569) |
---|
Predicted Species Reactivity | Human|Mouse|Rat |
---|---|
Product Format | Liquid. PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
Clonality | Polyclonal |
Isotype | IgG |
Host | Rabbit |
Application | Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry-Paraffin |
Additional Information | Modification Sites: H:Y410 M:Y408 R:Y409 |
Reconstitution and Storage | -20°C |
Immunogen | The antiserum was produced against synthesized peptide derived from human HCK around the phosphorylation site of Tyr410. |
Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
Peptide Sequence | Synthetic peptide located within the following region: DLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAIN |
Concentration | 1mg/ml |
Specificity | HCK (Phospho-Tyr410) Antibody detects endogenous levels of HCK only when phosphorylated at Tyr410. |
Intended Use | The product is for research use only, not for use in diagnostic or therapeutic procedures. |
Application Info | IF: 1:100~500 ELISA: 1:20000 |
Gene Symbol | HCK |
---|---|
Gene Full Name | HCK proto-oncogene, Src family tyrosine kinase |
Alias Symbols | hematopoietic cell kinase;hemopoietic cell kinase;JTK9;p59Hck;p59-HCK/p60-HCK;p61Hck;tyrosine-protein kinase HCK. |
NCBI Gene Id | 3055 |
Protein Name | Tyrosine-protein kinase HCK |
Description of Target | Non-receptor tyrosine-protein kinase found in hematopoietic cells that transmits signals from cell surface receptors and plays an important role in the regulation of innate immune responses, including neutrophil, monocyte, macrophage and mast cell functions, phagocytosis, cell survival and proliferation, cell adhesion and migration. Acts downstream of receptors that bind the Fc region of immunoglobulins, such as FCGR1A and FCGR2A, but also CSF3R, PLAUR, the receptors for IFNG, IL2, IL6 and IL8, and integrins, such as ITGB1 and ITGB2. During the phagocytic process, mediates mobilization of secretory lysosomes, degranulation, and activation of NADPH oxidase to bring about the respiratory burst. Plays a role in the release of inflammatory molecules. Promotes reorganization of the actin cytoskeleton and actin polymerization, formation of podosomes and cell protrusions. Inhibits TP73-mediated transcription activation and TP73-mediated apoptosis. Phosphorylates CBL in response to activation of immunoglobulin gamma Fc region receptors. Phosphorylates ADAM15, BCR, ELMO1, FCGR2A, GAB1, GAB2, RAPGEF1, STAT5B, TP73, VAV1 and WAS. |
Uniprot ID | P08631 |
Molecular Weight | 59 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "HCK Antibody (Phospho-Tyr410) (OAAF07569)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "HCK Antibody (Phospho-Tyr410) (OAAF07569)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "HCK Antibody (Phospho-Tyr410) (OAAF07569)" provided in?
This item is provided in "Liquid. PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "HCK Antibody (Phospho-Tyr410) (OAAF07569)"?
This target may also be called "hematopoietic cell kinase;hemopoietic cell kinase;JTK9;p59Hck;p59-HCK/p60-HCK;p61Hck;tyrosine-protein kinase HCK." in publications.
-
What is the shipping cost for "HCK Antibody (Phospho-Tyr410) (OAAF07569)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "HCK Antibody (Phospho-Tyr410) (OAAF07569)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "HCK Antibody (Phospho-Tyr410) (OAAF07569)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "59 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "HCK Antibody (Phospho-Tyr410) (OAAF07569)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "HCK"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "HCK"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "HCK"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "HCK"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "HCK"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "HCK"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.