HCK Antibody (Phospho-Tyr410) (OAAF07569)

Catalog No: OAAF07569 (Formerly GWB-ASB437)

Size:100 ug

Immunofluorescence analysis of HeLa cells, using HCK (Phospho-Tyr410) Antibody. The picture on the right is blocked with the phospho peptide.

Product Info

• Predicted Species Reactivity: Human|Mouse|Rat
• Product Format: Liquid. PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Clonality: Polyclonal
• Isotype: IgG
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry-Paraffin
• Additional Information: Modification Sites: H:Y410 M:Y408 R:Y409
  
• Reconstitution and Storage: -20°C
• Immunogen: The antiserum was produced against synthesized peptide derived from human HCK around the phosphorylation site of Tyr410.
• Purification: The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
• Peptide Sequence: Synthetic peptide located within the following region: DLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAIN
• Concentration: 1mg/ml
• Specificity: HCK (Phospho-Tyr410) Antibody detects endogenous levels of HCK only when phosphorylated at Tyr410.
• Intended Use: The product is for research use only, not for use in diagnostic or therapeutic procedures.
• Application Info: IF: 1:100~500
  ELISA: 1:20000
  

Target Info

• Gene Symbol: HCK
• Gene Full Name: HCK proto-oncogene, Src family tyrosine kinase
• Alias Symbols: hematopoietic cell kinase;hemopoietic cell kinase;JTK9;p59Hck;p59-HCK/p60-HCK;p61Hck;tyrosine-protein kinase HCK.
• NCBI Gene Id: 3055
• Protein Name: Tyrosine-protein kinase HCK
• Description of Target: Non-receptor tyrosine-protein kinase found in hematopoietic cells that transmits signals from cell surface receptors and plays an important role in the regulation of innate immune responses, including neutrophil, monocyte, macrophage and mast cell functions, phagocytosis, cell survival and proliferation, cell adhesion and migration. Acts downstream of receptors that bind the Fc region of immunoglobulins, such as FCGR1A and FCGR2A, but also CSF3R, PLAUR, the receptors for IFNG, IL2, IL6 and IL8, and integrins, such as ITGB1 and ITGB2. During the phagocytic process, mediates mobilization of secretory lysosomes, degranulation, and activation of NADPH oxidase to bring about the respiratory burst. Plays a role in the release of inflammatory molecules. Promotes reorganization of the actin cytoskeleton and actin polymerization, formation of podosomes and cell protrusions. Inhibits TP73-mediated transcription activation and TP73-mediated apoptosis. Phosphorylates CBL in response to activation of immunoglobulin gamma Fc region receptors. Phosphorylates ADAM15, BCR, ELMO1, FCGR2A, GAB1, GAB2, RAPGEF1, STAT5B, TP73, VAV1 and WAS.
• Uniprot ID: P08631
• Molecular Weight: 59 kDa