Hand2 Antibody - C-terminal region (ARP30571_P050)

Catalog No: ARP30571_P050

WB Suggested Anti-Hand2 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Heart

Host: Rabbit
Target Name: Hand2
Sample Type: Mouse Heart lysates
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: HAND2
Sample Tissue: Mouse Testis
Antibody Dilution: 3ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 87%
• Peptide Sequence: Synthetic peptide located within the following region: DQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Hand2 (ARP30571_P050) antibody is Catalog # AAP30571 (Previous Catalog # AAPP32996)

Target Info

• Gene Symbol: Hand2
• Gene Full Name: Heart and neural crest derivatives expressed transcript 2
• Alias Symbols: Hed, Th2, dHA, Ehan, Thin, bHLHa, dHAND, Ehand2, Thing2, bHLHa26, AI225906, AI661148
• NCBI Gene Id: 15111
• Protein Name: Heart- and neural crest derivatives-expressed protein 2
• Description of Target: Hand2 is essential for cardiac morphogenesis, particularly for the formation of the right ventricle and of the aortic arch arteries. It is required for vascular development and regulation of angiogenesis, possibly through a VEGF signaling pathway. It plays also an important role in limb development, particularly in the establishment of anterior-posterior polarization, acting as an upstream regulator of sonic hedgehog (SHH) induction in the limb bud. Hand2 is involved in the development of branchial arches, which give rise to unique structures in the head and neck.
• Uniprot ID: Q61039
• Protein Accession #: NP_034532
• Nucleotide Accession #: NM_010402
• Protein Size (# AA): 217
• Molecular Weight: 24kDa
• Protein Interactions: Nkx2-5; Hand1; Tcf3; Tcf4; Tcf12; Hoxd13; Twist1;