- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
H2AFX Antibody - N-terminal region (ARP58280_P050)
Datasheets/Manuals | Printable datasheet for anti-H2AFX (ARP58280_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human H2AFX |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100% |
Peptide Sequence | Synthetic peptide located within the following region: SGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVY |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-H2AFX (ARP58280_P050) antibody is Catalog # AAP58280 (Previous Catalog # AAPP32879) |
Sample Type Confirmation | There is BioGPS gene expression data showing that H2AFX is expressed in HepG2 |
Reference | Scherthan,H., (2008) Biochem. Biophys. Res. Commun. 371 (4), 694-697 |
Publications | Wen, W. et al. MST1 promotes apoptosis through phosphorylation of histone H2AX. J. Biol. Chem. 285, 39108-16 (2010). 20921231 |
Gene Symbol | H2AFX |
---|---|
Gene Full Name | H2A histone family, member X |
Alias Symbols | H2A.X, H2A/X, H2AFX |
NCBI Gene Id | 3014 |
Protein Name | Histone H2A.x |
Description of Target | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. H2AFX is a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif.Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Uniprot ID | P16104 |
Protein Accession # | NP_002096 |
Nucleotide Accession # | NM_002105 |
Protein Size (# AA) | 143 |
Molecular Weight | 16kDa |
Protein Interactions | UBC; HIST1H3A; USP17L2; UBD; RNF8; DDX21; XRCC6; NBN; NCL; HIST1H3B; ESR1; CENPA; TP53BP1; TOPORS; MDC1; BRCA1; ATR; ATM; PRKDC; CBX5; TRIM28; EGFR; BMI1; HIST2H3C; PML; XRCC5; UBB; TERF2; RNF2; SIRT7; CSNK2A1; ARRB2; ARRB1; PAXIP1; MRE11A; ATF2; MCPH1; C |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "H2AFX Antibody - N-terminal region (ARP58280_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish".
-
How long will it take to receive "H2AFX Antibody - N-terminal region (ARP58280_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "H2AFX Antibody - N-terminal region (ARP58280_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "H2AFX Antibody - N-terminal region (ARP58280_P050)"?
This target may also be called "H2A.X, H2A/X, H2AFX" in publications.
-
What is the shipping cost for "H2AFX Antibody - N-terminal region (ARP58280_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "H2AFX Antibody - N-terminal region (ARP58280_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "H2AFX Antibody - N-terminal region (ARP58280_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "16kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "H2AFX Antibody - N-terminal region (ARP58280_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "H2AFX"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "H2AFX"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "H2AFX"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "H2AFX"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "H2AFX"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "H2AFX"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.