GNB4 Antibody - middle region (ARP57549_P050)

Catalog No: ARP57549_P050

WB Suggested Anti-GNB4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HCT15 cell lysate

GNB4 antibody - middle region (ARP57549_P050) validated by WB using HEK293 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GNB4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: DGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GNB4 (ARP57549_P050) antibody is Catalog # AAP57549 (Previous Catalog # AAPP43035)
• Specificity: Gene Symbol:GNB1,GNB2,GNB3
  Protein Accession#:NP_002065,NP_005264,NP_002066
  Nucleotide Accession#:NM_002074,NM_005273,NM_002075
  Swissprot ID:P62873,P62879,P16520
  
• Subunit: beta1-4

Target Info

• Gene Symbol: GNB4
• Gene Full Name: Guanine nucleotide binding protein (G protein), beta polypeptide 4
• Alias Symbols: CMTD1F
• NCBI Gene Id: 59345
• Protein Name: Guanine nucleotide-binding protein subunit beta-4
• Description of Target: Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.
• Uniprot ID: Q9HAV0
• Protein Accession #: NP_067642
• Nucleotide Accession #: NM_021629
• Protein Size (# AA): 340
• Molecular Weight: 37kDa
• Protein Interactions: UBC; SUMO2; GNG8; GNG12; GNG2; GNG13; GNGT1; GNG11; GNG10; GNG7; GNG5; GNG4; GNG3; FBXO6; CDK18; ADRB2; PAN2; MTNR1A; ESR1; GNAI3; GNAI2; GNAI1; PDCL; CEP97; RGS6; Haus1; Haus4; Mau2; Trim69; Cdk1; MTNR1B; GNGT2; git11;