GLS Antibody - C-terminal region (ARP55098_P050)

Catalog No: ARP55098_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-GLS Antibody Titration: 0.2-1 ug/ml
Positive Control: ACHN cell lysateGLS is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells

GLS antibody - C-terminal region (ARP55098_P050) validated by WB antibody dilution at 1:1000.
Lane 5: rat kidney cortex
Lane 6: rat kidney proximal tubules
Lane 7: LLCPK1-F+ pig kidney proximal tubule tissue culture lysate
Lane 8: rat brain supernatant

Host: Rabbit
Target Name: GLS
Sample Tissue: Human U937 Whole Cell
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human, Rat
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the c terminal region of human GLS
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GLS (ARP55098_P050) antibody is Catalog # AAP55098 (Previous Catalog # AAPP32716)
• Sample Type Confirmation:

  GLS is strongly supported by BioGPS gene expression data to be expressed in ACHN

• Reference: Sahai (1983) [PubMed 6825316]
• Publications:

  Glutamine fuels proliferation but not migration of endothelial cells. EMBO J. 36, 2321-2333 (2017). 28659379

• Description:
  View product citations for GLS Antibody - C-terminal region (ARP55098_P050) on CiteAb

Target Info

• Gene Symbol: GLS
• Gene Full Name: Glutaminase
• Alias Symbols: GAC, GAM, KGA, GLS1, AAD20, DEE71, GDPAG, CASGID, EIEE71
• NCBI Gene Id: 2744
• Protein Name: Glutaminase kidney isoform, mitochondrial
• Description of Target: Sahai (1983) [PubMed 6825316] demonstrated phosphate-activated glutaminase (EC 3.5.1.2) in human platelets. It is the major enzyme yielding glutamate from glutamine. Significance of the enzyme derives from its possible implication in behavior disturbances
• Uniprot ID: O94925
• Protein Accession #: NP_055720
• Nucleotide Accession #: NM_014905
• Protein Size (# AA): 669
• Molecular Weight: 73kDa
• Protein Interactions: UBC; PEPD; MVD; GNS; MYL12A; GDA; EIF5A; CAPN1; ATF2; ATXN10; CUL5; TAX1BP3; PARD6A; SNTA1;