SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP36621_P050
Price: $0.00
SKU
ARP36621_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-GJC2 (ARP36621_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human GJC2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Rabbit: 100%
Peptide SequenceSynthetic peptide located within the following region: APASRTGSATSAGTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVW
Concentration0.5 mg/ml
Blocking PeptideFor anti-GJC2 (ARP36621_P050) antibody is Catalog # AAP36621 (Previous Catalog # AAPP07860)
Sample Type Confirmation

GJC2 is supported by BioGPS gene expression data to be expressed in HEK293T

ReferenceHenneke,M., (2008) Neurology 70 (10), 748-754
Gene SymbolGJC2
Gene Full NameGap junction protein, gamma 2, 47kDa
Alias SymbolsCx47, HLD2, GJA12, SPG44, CX46.6, LMPH1C, LMPHM3, PMLDAR
NCBI Gene Id57165
Protein NameGap junction gamma-2 protein
Description of TargetGJC2 is a gap junction protein. Gap junction proteins are members of a large family of homologous connexins and comprise 4 transmembrane, 2 extracellular, and 3 cytoplasmic domains. This gene plays a key role in central myelination and is involved in peripheral myelination in humans. Defects in this gene are the cause of autosomal recessive Pelizaeus-Merzbacher-like disease-1.This gene encodes a gap junction protein. Gap junction proteins are members of a large family of homologous connexins and comprise 4 transmembrane, 2 extracellular, and 3 cytoplasmic domains. This gene plays a key role in central myelination and is involved in peripheral myelination in humans. Defects in this gene are the cause of autosomal recessive Pelizaeus-Merzbacher-like disease-1.
Uniprot IDQ5T442
Protein Accession #NP_065168
Nucleotide Accession #NM_020435
Protein Size (# AA)439
Molecular Weight47kDa
Protein InteractionsALB;
  1. What is the species homology for "GJC2 Antibody - middle region (ARP36621_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rabbit".

  2. How long will it take to receive "GJC2 Antibody - middle region (ARP36621_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GJC2 Antibody - middle region (ARP36621_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GJC2 Antibody - middle region (ARP36621_P050)"?

    This target may also be called "Cx47, HLD2, GJA12, SPG44, CX46.6, LMPH1C, LMPHM3, PMLDAR" in publications.

  5. What is the shipping cost for "GJC2 Antibody - middle region (ARP36621_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GJC2 Antibody - middle region (ARP36621_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GJC2 Antibody - middle region (ARP36621_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "47kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GJC2 Antibody - middle region (ARP36621_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GJC2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GJC2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GJC2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GJC2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GJC2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GJC2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GJC2 Antibody - middle region (ARP36621_P050)
Your Rating
We found other products you might like!