website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100ug
$229.00
In Stock
Description of Target:
Gap junctions were first characterized by electron microscopy as regionally specialized structures on plasma membranes of contacting adherent cells. These structures were shown to consist of cell-to-cell channels. Proteins, called connexins, purified from fractions of enriched gap junctions from different tissues differ. The connexins are designated by their molecular mass. Another system of nomenclature divides gap junction proteins into 2 categories, alpha and beta, according to sequence similarities at the nucleotide and amino acid levels. For example, CX43 (MIM 121014) is designated alpha-1 gap junction protein, whereas CX32 (GJB1; MIM 304040) and CX26 are called beta-1 and beta-2 gap junction proteins, respectively. This nomenclature emphasizes that CX32 and CX26 are more homologous to each other than either of them is to CX43.
Gene Symbol:
GJB2
Official Gene Full Name:
Gap junction protein, beta 2, 26kDa
NCBI Gene Id:
2706
Alias Symbols:
HID; KID; PPK; CX26; DFNA3; DFNB1; NSRD1; DFNA3A; DFNB1A
Tissue Tool:
Find tissues and cell lines supported to express GJB2.
Protein Accession #:
NP_003995
Nucleotide Accession#:
NM_004004
Swissprot Id:
P29033
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Gap junction beta-2 protein
Protein Size (# AA):
226
Molecular Weight:
25kDa
Application:
WB
Partner Proteins:
C20orf4, GJA1, PRKACA, C20orf4, GJA1
Immunogen:
The immunogen for anti-GJB2 antibody: synthetic peptide directed towards the N terminal of human GJB2
Product Format:
Lyophilized powder
Purification:
Protein A purified
Complete computational species homology data:
GJB2 antibody - N-terminal region (ARP36608_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Horse: 100%; Human: 100%; Rat: 93%; Pig: 86%; Mouse: 86%; Sheep: 86%; Bovine: 86%; Guinea pig: 86%; Rabbit: 79%
Species Reactivity:
Human, Horse, Dog, Rat, Bovine, Sheep, Mouse, Guinea pig, Rabbit
Datasheets / Downloads:
Printable datasheet for
anti-GJB2 antibody
- ARP36608_T100
Peptide Sequence:
Synthetic peptide located within the following region: STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW
Blocking Peptide:
For anti-GJB2 antibody is Catalog # AAP36608 (Previous Catalog # AAPP07847)
Key Reference:
Hromas,R., et al., (2004) Neurosci. Res. 50 (1), 125-128
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-GJB2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question