website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$229.00
In Stock

GJB2 antibody - N-terminal region (ARP36608_T100)

Description of Target:
Gap junctions were first characterized by electron microscopy as regionally specialized structures on plasma membranes of contacting adherent cells. These structures were shown to consist of cell-to-cell channels. Proteins, called connexins, purified from fractions of enriched gap junctions from different tissues differ. The connexins are designated by their molecular mass. Another system of nomenclature divides gap junction proteins into 2 categories, alpha and beta, according to sequence similarities at the nucleotide and amino acid levels. For example, CX43 (MIM 121014) is designated alpha-1 gap junction protein, whereas CX32 (GJB1; MIM 304040) and CX26 are called beta-1 and beta-2 gap junction proteins, respectively. This nomenclature emphasizes that CX32 and CX26 are more homologous to each other than either of them is to CX43.
Gene Symbol:
GJB2
Official Gene Full Name:
Gap junction protein, beta 2, 26kDa
NCBI Gene Id:
2706
Alias Symbols:
HID; KID; PPK; CX26; DFNA3; DFNB1; NSRD1; DFNA3A; DFNB1A
Tissue Tool:
Find tissues and cell lines supported to express GJB2.
Protein Accession #:
NP_003995
Nucleotide Accession#:
NM_004004
Swissprot Id:
P29033
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Gap junction beta-2 protein
Protein Size (# AA):
226
Molecular Weight:
25kDa
Application:
WB
Protein Interactions:
CD14; CNST; FBXO2; SKP1; UBC; GJB6; CAV1; GJB1;
Immunogen:
The immunogen for anti-GJB2 antibody: synthetic peptide directed towards the N terminal of human GJB2
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Protein A purified
Complete computational species homology data:
GJB2 antibody - N-terminal region (ARP36608_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Horse: 100%; Human: 100%; Rat: 93%; Pig: 86%; Mouse: 86%; Sheep: 86%; Bovine: 86%; Guinea pig: 86%; Rabbit: 79%
Species Reactivity:
Human, Horse, Dog, Rat, Bovine, Sheep, Mouse, Guinea pig, Rabbit
Datasheets / Downloads:
Printable datasheet for
anti-GJB2 antibody
- ARP36608_T100
Peptide Sequence:
Synthetic peptide located within the following region: STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW
Blocking Peptide:
For anti-GJB2 antibody is Catalog # AAP36608 (Previous Catalog # AAPP07847)
Target Reference:
Hromas,R., et al., (2004) Neurosci. Res. 50 (1), 125-128
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: GJB2 antibody tested with Human Fetal Lung Tissue (ARP36608_T100)

Aviva Systems Biology is the original manufacturer of this GJB2 antibody (ARP36608_T100)

Click here to view the GJB2 antibody Western Blot Protocol

Product Datasheet Link: GJB2 antibody (ARP36608_T100)

WB Suggested Anti-GJB2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Fetal lung

Western Blot image:


Description of Target: Gap junctions were first characterized by electron microscopy as regionally specialized structures on plasma membranes of contacting adherent cells. These structures were shown to consist of cell-to-cell channels. Proteins, called connexins, purified from fractions of enriched gap junctions from different tissues differ. The connexins are designated by their molecular mass. Another system of nomenclature divides gap junction proteins into 2 categories, alpha and beta, according to sequence similarities at the nucleotide and amino acid levels. For example, CX43 (MIM 121014) is designated alpha-1 gap junction protein, whereas CX32 (GJB1; MIM 304040) and CX26 are called beta-1 and beta-2 gap junction proteins, respectively. This nomenclature emphasizes that CX32 and CX26 are more homologous to each other than either of them is to CX43.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s GJB2 antibody (ARP36608_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Review: GJB2 antibody - N-terminal region (ARP36608_T100) in mCx26 elution fraction 6 and 7 using WB

Product Page for GJB2 antibody - N-terminal region (ARP36608_T100)

Researcher: Juan Zou, Georgia state unviersity
Application: Western Blotting
Species+tissue/cell type:
Lane 1: 4ug mCx26 elution fraction 6
Lane 2: 4ug mCx26 elution fraction 7
Lane 3: 4ug mCx26 elution fraction 6 + other Cx26 antibody
Lane 4: 4ug mCx26 elution fraction 7 + other Cx26 antibody
Primary antibody dilution: 1:3000
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:3000

 Questionnaire:
 How do Aviva’s reagents play a role in your experimental goals?  Before I receiving Aviva, I even did not know the existence of it. Our lab purchased antibodies from different companies. But after I tried this sample from Aviva, I have to say this antibody is very sensitive.
 How would you rate this antibody on a scale from 1-5 (5=best) nad why? 4
 Would you use this antibody in future experiment? Yes, I will.
 Have you used another antibody which has worked in your application? Yes.
 Do you believe the information about the reagent on Aviva’s website is correct? Yes.
 If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?  Yes, for part of my experiment, I will use it to verify my mouse Cx26 from purified insect cell. But for other experiment, especially for cell image, I have to find other good antibody which can specifically recognize human Cx26.
 How did you store the antibody after re-suspension? I stored it in -20 d C fridge.
 Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): 4ug protein
 How many different experimental trials were conducted using the antibody sample? I only tried western blot for targeting human and mouse Cx26. But it only works for mouse Cx26.
 How was this sample prepared?  10ul of purified mouse Cx26 was mixed with 10ul 2x SDS-Page sample buffer, incubate at room temperature for 1 hour before running the SDS-Page.
 Primary antibody dilution and incubation time:  1:3000, overnight at 4 d C.
 Secondary antibody used and dilution and incubation time: 1:3000, 1 hour at room temperature.
 What controls were used in your experiment (positive/negative)? Negative controls
 Please include your detailed WB Procedure/Protocol here: 1. Run 12.5% SDS-Page gel
2. Transfer protein on the gel to nitrocellulose membrane
3. Block the membrane for 1 hour at room temperature or overnight at 4°C using 5% blocking solution.
4. Incubate membrane with 1:3000 dilutions of primary antibody in 5%  blocking solution overnight at 4°C
5. Wash the membrane in three washes of TBST, 5 minutes each.
6. Incubate the membrane with the 1:3000 dilution of labeled secondary antibody in 5% blocking buffer in TBST at room temperature for 1 hour.
7. Wash the membrane in three washes of TBST, 5 minutes each, then rinse in TBS.
8. For signal development, follow the kit manufacturer’s recommendations.
9. Remove excess reagent and cover the membrane in transparent plastic wrap.
10.Acquire image using darkroom development techniques for chemiluminesence

I used Abcam western blot protocol(http://www.abcam.com/index.html?pageconfig=resource&rid=13045)

 
X
Ask a Question