website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GJB2 antibody - N-terminal region (ARP36608_T100)

  • Catalog#: ARP36608_T100
  • Domestic: within 1-2 days delivery International: 1-2 days
    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges
    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Free trial-size samples may be available for this item. Please go here for more information.
Print Page
100 ul
    In Stock

    Conjugation Options

    ARP36608_T100-FITC Conjugated

    ARP36608_T100-HRP Conjugated

    ARP36608_T100-Biotin Conjugated

    Free trial-size samples may be available for this item. Please go here for more information.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    Gap junction protein, beta 2, 26kDa
    Protein Name:
    Gap junction beta-2 protein
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    Replacement Item:
    This antibody may replace item sc-130729 from Santa Cruz Biotechnology.
    Description of Target:
    Gap junctions were first characterized by electron microscopy as regionally specialized structures on plasma membranes of contacting adherent cells. These structures were shown to consist of cell-to-cell channels. Proteins, called connexins, purified from fractions of enriched gap junctions from different tissues differ. The connexins are designated by their molecular mass. Another system of nomenclature divides gap junction proteins into 2 categories, alpha and beta, according to sequence similarities at the nucleotide and amino acid levels. For example, CX43 (MIM 121014) is designated alpha-1 gap junction protein, whereas CX32 (GJB1; MIM 304040) and CX26 are called beta-1 and beta-2 gap junction proteins, respectively. This nomenclature emphasizes that CX32 and CX26 are more homologous to each other than either of them is to CX43.
    Protein Size (# AA):
    Molecular Weight:
    Protein A purified
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express GJB2.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express GJB2.
    The immunogen is a synthetic peptide directed towards the N terminal region of human GJB2
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
    Predicted Homology Based on Immunogen Sequence:
    Cow: 86%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 93%; Sheep: 86%
    Complete computational species homology data:
    Anti-GJB2 (ARP36608_T100)
    Peptide Sequence:
    Synthetic peptide located within the following region: STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    CD14; CNST; FBXO2; SKP1; UBC; GJB6; CAV1; GJB1;
    Blocking Peptide:
    For anti-GJB2 (ARP36608_T100) antibody is Catalog # AAP36608 (Previous Catalog # AAPP07847)
    Datasheets / Downloads:
    Printable datasheet for anti-GJB2 (ARP36608_T100) antibody
    Target Reference:
    Hromas,R., et al., (2004) Neurosci. Res. 50 (1), 125-128

    Product Protocols: GJB2 antibody tested with Human Fetal Lung Tissue (ARP36608_T100)

    Aviva Systems Biology is the original manufacturer of this GJB2 antibody (ARP36608_T100)

    Click here to view the GJB2 antibody Western Blot Protocol

    Product Datasheet Link: GJB2 antibody (ARP36608_T100)

    WB Suggested Anti-GJB2 Antibody Titration: 1.25ug/ml
    ELISA Titer: 1:62500
    Positive Control: Fetal lung

    Western Blot image:

    Description of Target: Gap junctions were first characterized by electron microscopy as regionally specialized structures on plasma membranes of contacting adherent cells. These structures were shown to consist of cell-to-cell channels. Proteins, called connexins, purified from fractions of enriched gap junctions from different tissues differ. The connexins are designated by their molecular mass. Another system of nomenclature divides gap junction proteins into 2 categories, alpha and beta, according to sequence similarities at the nucleotide and amino acid levels. For example, CX43 (MIM 121014) is designated alpha-1 gap junction protein, whereas CX32 (GJB1; MIM 304040) and CX26 are called beta-1 and beta-2 gap junction proteins, respectively. This nomenclature emphasizes that CX32 and CX26 are more homologous to each other than either of them is to CX43.

    Questions pertaining to this data can be directed to

    Aviva Systems Biology’s GJB2 antibody (ARP36608_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

    Product Review: GJB2 antibody - N-terminal region (ARP36608_T100) in mCx26 elution fraction 6 and 7 using WB

    Product Page for GJB2 antibody - N-terminal region (ARP36608_T100)

    Researcher: Juan Zou, Georgia state unviersity
    Application: Western Blotting
    Species+tissue/cell type:
    Lane 1: 4ug mCx26 elution fraction 6
    Lane 2: 4ug mCx26 elution fraction 7
    Lane 3: 4ug mCx26 elution fraction 6 + other Cx26 antibody
    Lane 4: 4ug mCx26 elution fraction 7 + other Cx26 antibody
    Primary antibody dilution: 1:3000
    Secondary antibody: Anti-rabbit-HRP
    Secondary antibody dilution: 1:3000

     How do Aviva’s reagents play a role in your experimental goals? Before I receiving Aviva, I even did not know the existence of it. Our lab purchased antibodies from different companies. But after I tried this sample from Aviva, I have to say this antibody is very sensitive.
     How would you rate this antibody on a scale from 1-5 (5=best) nad why?4
     Would you use this antibody in future experiment?Yes, I will.
     Have you used another antibody which has worked in your application?Yes.
     Do you believe the information about the reagent on Aviva’s website is correct?Yes.
     If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes, for part of my experiment, I will use it to verify my mouse Cx26 from purified insect cell. But for other experiment, especially for cell image, I have to find other good antibody which can specifically recognize human Cx26.
     How did you store the antibody after re-suspension?I stored it in -20 d C fridge.
     Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel):4ug protein
     How many different experimental trials were conducted using the antibody sample?I only tried western blot for targeting human and mouse Cx26. But it only works for mouse Cx26.
     How was this sample prepared? 10ul of purified mouse Cx26 was mixed with 10ul 2x SDS-Page sample buffer, incubate at room temperature for 1 hour before running the SDS-Page.
     Primary antibody dilution and incubation time: 1:3000, overnight at 4 d C.
     Secondary antibody used and dilution and incubation time:1:3000, 1 hour at room temperature.
     What controls were used in your experiment (positive/negative)?Negative controls
     Please include your detailed WB Procedure/Protocol here:1. Run 12.5% SDS-Page gel
    2. Transfer protein on the gel to nitrocellulose membrane
    3. Block the membrane for 1 hour at room temperature or overnight at 4°C using 5% blocking solution.
    4. Incubate membrane with 1:3000 dilutions of primary antibody in 5%  blocking solution overnight at 4°C
    5. Wash the membrane in three washes of TBST, 5 minutes each.
    6. Incubate the membrane with the 1:3000 dilution of labeled secondary antibody in 5% blocking buffer in TBST at room temperature for 1 hour.
    7. Wash the membrane in three washes of TBST, 5 minutes each, then rinse in TBS.
    8. For signal development, follow the kit manufacturer’s recommendations.
    9. Remove excess reagent and cover the membrane in transparent plastic wrap.
    10.Acquire image using darkroom development techniques for chemiluminesence

    I used Abcam western blot protocol(

    Ask a Question