- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for GFAP Antibody (Phospho-Ser38) (OAAF07655) |
|---|
| Predicted Species Reactivity | Human|Mouse|Rat |
|---|---|
| Product Format | LiquidPBS (without Mg2+ and Ca2+) (pH 7.4), 150mM NaCl, 0.02% sodium azide and 50% glycerol |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Application | Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot |
| Reconstitution and Storage | -20°C |
| Immunogen | The antiserum was produced against synthesized peptide derived from human GFAP around the phosphorylation site of Ser38. |
| Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
| Peptide Sequence | Synthetic peptide located within the following region: RRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNA |
| Concentration | 1 mg/ml |
| Target Post-Translational Modification | Human:S38 |
| Specificity | GFAP (Phospho-Ser38) Antibody detects endogenous levels of GFAP only when phosphorylated at Ser38. |
| Application Info | WB: 1:500~1000 IHC: 1:50~100 IF: 1:100~500 ELISA: 1:5000 |
| Gene Symbol | GFAP |
|---|---|
| Gene Full Name | glial fibrillary acidic protein |
| Alias Symbols | ALXDRD;glial fibrillary acidic protein. |
| NCBI Gene Id | 2670 |
| Protein Name | Glial fibrillary acidic protein |
| Description of Target | GFAP, a class-III intermediate filament, is a cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells. |
| Uniprot ID | P14136 |
| Molecular Weight | 49 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "GFAP Antibody (Phospho-Ser38) (OAAF07655)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "GFAP Antibody (Phospho-Ser38) (OAAF07655)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "GFAP Antibody (Phospho-Ser38) (OAAF07655)" provided in?
This item is provided in "LiquidPBS (without Mg2+ and Ca2+) (pH 7.4), 150mM NaCl, 0.02% sodium azide and 50% glycerol ".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "GFAP Antibody (Phospho-Ser38) (OAAF07655)"?
This target may also be called "ALXDRD;glial fibrillary acidic protein." in publications.
-
What is the shipping cost for "GFAP Antibody (Phospho-Ser38) (OAAF07655)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "GFAP Antibody (Phospho-Ser38) (OAAF07655)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "GFAP Antibody (Phospho-Ser38) (OAAF07655)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "49 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "GFAP Antibody (Phospho-Ser38) (OAAF07655)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "GFAP"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "GFAP"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "GFAP"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "GFAP"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "GFAP"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "GFAP"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
