SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP31855_T100-Biotin
Size:100ul
Price: $384.00
SKU
ARP31855_T100-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

GATA2 Antibody - N-terminal region : Biotin (ARP31855_T100-Biotin)

Datasheets/ManualsPrintable datasheet for anti-GATA2 (ARP31855_T100-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GATA2
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA
Concentration0.5 mg/ml
Blocking PeptideFor anti-GATA2 (ARP31855_T100-Biotin) antibody is Catalog # AAP31855 (Previous Catalog # AAPP02650)
Sample Type Confirmation

GATA2 is strongly supported by BioGPS gene expression data to be expressed in K562

ReferenceTsuzuki, S., et al., (2004) Mol. Cell. Biol. 24 (15), 6824-6836
Publications

Mammoto, A. et al. A mechanosensitive transcriptional mechanism that controls angiogenesis. Nature 457, 1103-8 (2009). WB, IHC, IP, EMSA, ChIP, Rat, Human, Bovine, Dog, Horse, Rabbit, Guinea pig, Mouse 19242469

Huang, Y.-J. et al. The functional IGFBP7 promoter -418G>A polymorphism and risk of head and neck cancer. Mutat. Res. 702, 32-9 (2010). WB, IHC, IP, EMSA, ChIP, Rat, Human, Bovine, Dog, Horse, Rabbit, Guinea pig, Mouse 20599521

Jack, B. H. A. & Crossley, M. GATA proteins work together with friend of GATA (FOG) and C-terminal binding protein (CTBP) co-regulators to control adipogenesis. J. Biol. Chem. 285, 32405-14 (2010). WB, IHC, IP, EMSA, ChIP, Rat, Human, Bovine, Dog, Horse, Rabbit, Guinea pig, Mouse 20705609

Fujiwara, T. et al. Gene expression profiling identifies HOXB4 as a direct downstream target of GATA-2 in human CD34+ hematopoietic cells. PLoS One 7, e40959 (2012). WB, IHC, IP, EMSA, ChIP, Rat, Human, Bovine, Dog, Horse, Rabbit, Guinea pig, Mouse 23028422

Wang, F. et al. A regulatory circuit comprising GATA1/2 switch and microRNA-27a/24 promotes erythropoiesis. Nucleic Acids Res. 42, 442-57 (2014). WB, IHC, IP, EMSA, ChIP, Rat, Human, Bovine, Dog, Horse, Rabbit, Guinea pig, Mouse 24049083

Gene SymbolGATA2
Gene Full NameGATA binding protein 2
Alias SymbolsDCML, IMD21, NFE1B, MONOMAC
NCBI Gene Id2624
Protein NameEndothelial transcription factor GATA-2
Description of TargetThe GATA family of transcription factors, which contain zinc fingers in their DNA binding domain, have emerged as candidate regulators of gene expression in hematopoietic cells is essential for normal primitive and definitive erythropoiesis and is expressed at high levels in erythroid cells, mast cells, and megakaryocytes. GATA2 is expressed in hematopoietic progenitors, including early erythroid cells, mast cells, and megakaryocytes, and also in nonhematopoietic embryonic stem cells.
Uniprot IDP23769
Protein Accession #NP_116027
Nucleotide Accession #NM_032638
Protein Size (# AA)480
Molecular Weight50kDa
Protein InteractionsNOTCH2NL; KRTAP10-3; KRTAP10-9; KRT40; PRR20A; ADAMTSL4; TRAF1; PSMA3; MDFI; GOLGA2; FHL3; TRIM23; AKT1; BMI1; SPI1; SMAD4; ELAVL1; KAT2A; EP300; MED1; POU1F1; POU2AF1; ZBTB32; ZFPM1; ZBTB16; HDAC5; HDAC3; HHEX; RARA; RXRA; MAPK1; JUN; CEBPA; STAT3; PML;
  1. What is the species homology for "GATA2 Antibody - N-terminal region : Biotin (ARP31855_T100-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "GATA2 Antibody - N-terminal region : Biotin (ARP31855_T100-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GATA2 Antibody - N-terminal region : Biotin (ARP31855_T100-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GATA2 Antibody - N-terminal region : Biotin (ARP31855_T100-Biotin)"?

    This target may also be called "DCML, IMD21, NFE1B, MONOMAC" in publications.

  5. What is the shipping cost for "GATA2 Antibody - N-terminal region : Biotin (ARP31855_T100-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GATA2 Antibody - N-terminal region : Biotin (ARP31855_T100-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GATA2 Antibody - N-terminal region : Biotin (ARP31855_T100-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "50kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GATA2 Antibody - N-terminal region : Biotin (ARP31855_T100-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GATA2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GATA2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GATA2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GATA2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GATA2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GATA2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GATA2 Antibody - N-terminal region : Biotin (ARP31855_T100-Biotin)
Your Rating
We found other products you might like!