SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP63943_P050
Price: $0.00
SKU
ARP63943_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-FUT3 (ARP63943_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Cow, Dog
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 79%; Human: 100%
Peptide SequenceSynthetic peptide located within the following region: DKDHARYLSYFRWRETLRPRSFSWALDFCKACWKLQQESRYQTVRSIAAW
Concentration0.5 mg/ml
Blocking PeptideFor anti-FUT3 (ARP63943_P050) antibody is Catalog # AAP63943
Sample Type Confirmation

FUT3 is supported by BioGPS gene expression data to be expressed in 721_B

Gene SymbolFUT3
Gene Full NameFucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group)
Alias SymbolsLE, Les, FT3B, CD174, FucT-III
NCBI Gene Id2525
Protein NameGalactoside 3(4)-L-fucosyltransferase
Description of TargetThe Lewis histo-blood group system comprises a set of fucosylated glycosphingolipids that are synthesized by exocrine epithelial cells and circulate in body fluids. The glycosphingolipids function in embryogenesis, tissue differentiation, tumor metastasis, inflammation, and bacterial adhesion. They are secondarily absorbed to red blood cells giving rise to their Lewis phenotype. This gene is a member of the fucosyltransferase family, which catalyzes the addition of fucose to precursor polysaccharides in the last step of Lewis antigen biosynthesis. It encodes an enzyme with alpha(1,3)-fucosyltransferase and alpha(1,4)-fucosyltransferase activities. Mutations in this gene are responsible for the majority of Lewis antigen-negative phenotypes. Multiple alternatively spliced variants, encoding the same protein, have been found for this gene.
Uniprot IDP21217
Protein Accession #NP_000140
Nucleotide Accession #NM_000149
Protein Size (# AA)361
Molecular Weight42kDa
  1. What is the species homology for "FUT3 Antibody - C-terminal region (ARP63943_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Cow, Dog".

  2. How long will it take to receive "FUT3 Antibody - C-terminal region (ARP63943_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FUT3 Antibody - C-terminal region (ARP63943_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FUT3 Antibody - C-terminal region (ARP63943_P050)"?

    This target may also be called "LE, Les, FT3B, CD174, FucT-III" in publications.

  5. What is the shipping cost for "FUT3 Antibody - C-terminal region (ARP63943_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FUT3 Antibody - C-terminal region (ARP63943_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FUT3 Antibody - C-terminal region (ARP63943_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FUT3 Antibody - C-terminal region (ARP63943_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "FUT3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FUT3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FUT3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FUT3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FUT3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FUT3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FUT3 Antibody - C-terminal region (ARP63943_P050)
Your Rating
We found other products you might like!