FPGS Antibody - middle region (ARP63438_P050)

Catalog No: ARP63438_P050

WB Suggested Anti-FPGS Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Heart

Rabbit Anti-FPGS Antibody
Catalog Number: ARP63438_P050
Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
Observed Staining: Cytoplasmic in mitochondria
Primary Antibody Concentration: N/A
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: CWLQRQDRHGAGEPKASRPGLLWQLPLAPVFQPTSHMRLGLRNTEWPGRT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FPGS (ARP63438_P050) antibody is Catalog # AAP63438
• Publications:

  A folylpoly-γ-glutamate synthase single nucleotide polymorphism associated with response to pemetrexed treatment combined with platinum for non-small cell lung cancer. Lung Cancer. 102, 15-20 (2016). 27987582

Target Info

• Gene Symbol: FPGS
• Gene Full Name: Folylpolyglutamate synthase
• Alias Symbols: -
• NCBI Gene Id: 2356
• Protein Name: Folylpolyglutamate synthase, mitochondrial
• Description of Target: This gene encodes the folylpolyglutamate synthetase enzyme. This enzyme has a central role in establishing and maintaining both cytosolic and mitochondrial folylpolyglutamate concentrations and, therefore, is essential for folate homeostasis and the survival of proliferating cells. This enzyme catalyzes the ATP-dependent addition of glutamate moieties to folate and folate derivatives. While several transcript variants may exist for this gene, the full-length natures of only two have been biologically validated to date. These two variants encode distinct isoforms.
• Uniprot ID: Q5JU19
• Protein Accession #: NP_001018088
• Nucleotide Accession #: NM_001018078
• Protein Size (# AA): 537
• Molecular Weight: 59kDa
• Protein Interactions: UBC;