website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100ug
$229.00
In Stock

FOXP3 antibody - N-terminal region (ARP32743_T100)

Receive a free positive control (AHL001) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Publications:

Anti-FOXP3 ARP32743_T100 has recently been referenced in the following publications:

Kawabata, A. et al. Naïve rat umbilical cord matrix stem cells significantly attenuate mammary tumor growth through modulation of endogenous immune responses. Cytotherapy 15, 586–97 (2013). , 23474329

Description of Target:
Forkhead box protein P3 (FOXP3, Scurfin, Zinc finger protein JM2) encodes a novel member of the forkhead family of transcription factors. It presumably represses transcription, playing a paramount role in determining the amplitude of the response of CD4 T cells to activation
Gene Symbol:
FOXP3
Official Gene Full Name:
Forkhead box P3
NCBI Gene Id:
50943
Alias Symbols:
JM2; AIID; IPEX; PIDX; XPID; DIETER
Tissue Tool:
Find tissues and cell lines supported to express FOXP3.
Protein Accession #:
NP_054728
Nucleotide Accession#:
NM_014009
Swissprot Id:
Q9BZS1
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Forkhead box protein P3
Protein Size (# AA):
431
Molecular Weight:
47kDa
Application:
IHC, WB
Immunogen:
The immunogen for anti-FOXP3 antibody: synthetic peptide directed towards the N terminal of human FOXP3
Product Format:
Lyophilized powder
Purification:
Protein A purified
Complete computational species homology data:
FOXP3 antibody - N-terminal region (ARP32743_T100)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Horse: 93%; Mouse: 93%; Rat: 86%; Rabbit: 86%; Guinea pig: 86%; Dog: 79%
Species Reactivity:
Human, Pig, Sheep, Bovine, Horse, Mouse, Rat, Rabbit, Guinea pig, Dog
Datasheets / Downloads:
Printable datasheet for
anti-FOXP3 antibody
- ARP32743_T100
Peptide Sequence:
Synthetic peptide located within the following region: PHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGL
Blocking Peptide:
For anti-FOXP3 antibody is Catalog # AAP32743 (Previous Catalog # AAPP03757)
Key Reference:
Takahata,Y., et al., (2004) Exp.Hematol.32(7),622-629
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-FOXP3 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question