website statistics
Account Login 

Aviva Systems Biology office will be closed for Memorial Day - 5/30/2016.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!


FOXP3 antibody - N-terminal region (ARP32743_T100)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
In Stock
Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Forkhead box P3
Protein Name:
Forkhead box protein P3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
Forkhead box protein P3 (FOXP3, Scurfin, Zinc finger protein JM2) encodes a novel member of the forkhead family of transcription factors. It presumably represses transcription, playing a paramount role in determining the amplitude of the response of CD4 T cells to activation
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FOXP3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FOXP3.
The immunogen is a synthetic peptide directed towards the N terminal region of human FOXP3
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 79%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 86%; Sheep: 100%
Complete computational species homology data:
Anti-FOXP3 (ARP32743_T100)
Peptide Sequence:
Synthetic peptide located within the following region: PHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FOXP3 (ARP32743_T100) antibody is Catalog # AAP32743 (Previous Catalog # AAPP03757)
Datasheets / Downloads:
Printable datasheet for anti-FOXP3 (ARP32743_T100) antibody
Target Reference:
Takahata,Y., et al., (2004) Exp.Hematol.32(7),622-629

Kawabata, A. et al. Naïve rat umbilical cord matrix stem cells significantly attenuate mammary tumor growth through modulation of endogenous immune responses. Cytotherapy 15, 586-97 (2013). IHC, Human, Pig, Sheep, Bovine, Horse, Mouse, Rat, Rabbit, Guinea pig, Dog 23474329

Product Review: FOXP3 Antibody (ARP32743_T100) with frozen mouse spleen sections

Product Review:
Atsushi Kawabata at Kansas State University; Dept of Anatomy and Physiology

Product Review: FOXP3 Antibody (ARP32743_T100) with frozen mouse spleen sections

FOXP3 (ARP32743_T100) Immunohistochemistry

FOXP3 (ARP32743_T100) mouse spleen

Tissue: Mouse spleen

Section: Frozen 4mm


  1. Cut frozen sections at 4 mm.
  2. Fix them with acetone for 10min at 4C.
  3. Dry them for a few hours.
  4. Rinse them with PBS 3times (each 5min)
  5. Incubate them with blocking solution (normal goat serum, Vector Lab) for 20min at 37C.
  6. Rinse them with PBS 3times (each 5min)
  7. Incubate them with the primary antibody (Foxp3; ARP32743_T100, 1: 100) for 1hr at 37C.
  8. Rinse them with PBS 3times (each 5min)
  9. Incubate them with the secondary antibody (goat biotin-conjugated anti rabbit IgG, Vector Lab, 1;100)

10.  Rinse them with PBS 3times (each 5min)

11.  Incubate them with ABC reagent (we use the Vector`s ABC kit) for 40 min at 37C.

12.  Rinse them with PBS 3times (each 5min)

13.  DAB reaction

14.  Counterstain with hematoxylin


As you can see the microscopic figures, there are a few positive lymphocytes in the mouse spleen (2-3 cells/400x). However, no lymphocytes are positive in the negative control (no primary antibody).

Product Protocols: FOXP3 antibody tested with Human Hepg2 Cells (ARP32743_T100)

Aviva Systems Biology is the original manufacturer of this FOXP3 antibody (ARP32743_T100)

Click here to view the FOXP3 antibody Western Blot Protocol

Product Datasheet Link: FOXP3 antibody (ARP32743_T100)

WB Suggested Anti-FOXP3 Antibody Titration: 5.0-8.0ug/ml
Positive Control: HepG2

Western Blot image:

Description of Target: Forkhead box protein P3 (FOXP3, Scurfin, Zinc finger protein JM2) encodes a novel member of the forkhead family of transcription factors. It presumably represses transcription, playing a paramount role in determining the amplitude of the response of CD4 T cells to activation

Questions pertaining to this data can be directed to

Aviva Systems Biology’s FOXP3 antibody (ARP32743_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: FOXP3 antibody tested by IHC with human liver (ARP32743)

Aviva Systems Biology is the original manufacturer of this FOXP3 antibody.

Click here to view the FOXP3 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: FOXP3 antibody (ARP32743)

IHC Information:

Rabbit Anti-FOXP3 Antibody
Catalog Number: ARP32743
Paraffin Embedded Tissue: Human Liver
Cellular Data: Liver cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question