website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

FOXP3 antibody - N-terminal region (ARP32743_T100)

Receive a free positive control (AHL001) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
Forkhead box protein P3 (FOXP3, Scurfin, Zinc finger protein JM2) encodes a novel member of the forkhead family of transcription factors. It presumably represses transcription, playing a paramount role in determining the amplitude of the response of CD4 T cells to activation
Gene Symbol:
Official Gene Full Name:
Forkhead box P3
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express FOXP3.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Forkhead box protein P3
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-FOXP3 antibody: synthetic peptide directed towards the N terminal of human FOXP3
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Protein A purified
Complete computational species homology data:
FOXP3 antibody - N-terminal region (ARP32743_T100)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Horse: 93%; Mouse: 93%; Rat: 86%; Rabbit: 86%; Guinea pig: 86%; Dog: 79%
Species Reactivity:
Human, Pig, Sheep, Bovine, Horse, Mouse, Rat, Rabbit, Guinea pig, Dog
Datasheets / Downloads:
Printable datasheet for
anti-FOXP3 antibody
- ARP32743_T100
Peptide Sequence:
Synthetic peptide located within the following region: PHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGL
Blocking Peptide:
For anti-FOXP3 antibody is Catalog # AAP32743 (Previous Catalog # AAPP03757)
Target Reference:
Takahata,Y., et al., (2004) Exp.Hematol.32(7),622-629
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Anti-FOXP3 ARP32743_T100 has recently been referenced in the following publications:

Kawabata, A. et al. Naïve rat umbilical cord matrix stem cells significantly attenuate mammary tumor growth through modulation of endogenous immune responses. Cytotherapy 15, 586–97 (2013). 23474329

Product Review: FOXP3 Antibody (ARP32743_T100) with frozen mouse spleen sections

Product Review:
Atsushi Kawabata at Kansas State University; Dept of Anatomy and Physiology

Product Review: FOXP3 Antibody (ARP32743_T100) with frozen mouse spleen sections

FOXP3 (ARP32743_T100) Immunohistochemistry

FOXP3 (ARP32743_T100) mouse spleen

Tissue: Mouse spleen

Section: Frozen 4mm


  1. Cut frozen sections at 4 mm.
  2. Fix them with acetone for 10min at 4C.
  3. Dry them for a few hours.
  4. Rinse them with PBS 3times (each 5min)
  5. Incubate them with blocking solution (normal goat serum, Vector Lab) for 20min at 37C.
  6. Rinse them with PBS 3times (each 5min)
  7. Incubate them with the primary antibody (Foxp3; ARP32743_T100, 1: 100) for 1hr at 37C.
  8. Rinse them with PBS 3times (each 5min)
  9. Incubate them with the secondary antibody (goat biotin-conjugated anti rabbit IgG, Vector Lab, 1;100)

10.  Rinse them with PBS 3times (each 5min)

11.  Incubate them with ABC reagent (we use the Vector`s ABC kit) for 40 min at 37C.

12.  Rinse them with PBS 3times (each 5min)

13.  DAB reaction

14.  Counterstain with hematoxylin


As you can see the microscopic figures, there are a few positive lymphocytes in the mouse spleen (2-3 cells/400x). However, no lymphocytes are positive in the negative control (no primary antibody).

Computational species homology for FOXP3 antibody (ARP32743)

Product page for FOXP3 antibody (ARP32743)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant FOXP3 antibody; Loxodonta africana FOXP3 antibody G3SSI5 100%
Bovine FOXP3 antibody; Bos taurus FOXP3 antibody Q2LEZ0 100%
Bovine FOXP3 antibody; Bos taurus FOXP3 antibody F1MSV7 100%
Cat FOXP3 antibody; Felis catus FOXP3 antibody A3RJW9 92%
Chinese hamster Foxp3 antibody; Cricetulus griseus Foxp3 antibody G3HNB1 85%
Crab-eating macaque FOXP3 antibody; Macaca fascicularis FOXP3 antibody Q6U8D7 100%
Dog FOXP3 antibody; Canis familiaris FOXP3 antibody D0VYJ3 78%
Giant panda FOXP3 antibody; Ailuropoda melanoleuca FOXP3 antibody G1M0B6 85%
Guinea pig LOC100735602 antibody; Cavia porcellus LOC100735602 antibody H0V8Z3 85%
Horse FOXP3 antibody; Equus caballus FOXP3 antibody F6UP71 92%
Horse FOXP3 antibody; Equus caballus FOXP3 antibody B2CXY8 92%
Human FOXP3 antibody; Homo sapiens FOXP3 antibody Q9BZS1 100%
Human FOXP3 antibody; Homo sapiens FOXP3 antibody Q9BZS1-3 100%
Human FOXP3 antibody; Homo sapiens FOXP3 antibody Q9BZS1-2 100%
Human FOXP3 antibody; Homo sapiens FOXP3 antibody B9UN80 100%
Human FOXP3 antibody; Homo sapiens FOXP3 antibody B7ZLG1 100%
Little brown bat FOXP3 antibody; Myotis lucifugus FOXP3 antibody G1P5E1 92%
Lowland gorilla FOXP3 antibody; Gorilla gorilla gorilla FOXP3 antibody G3RR60 100%
Lowland gorilla FOXP3 antibody; Gorilla gorilla gorilla FOXP3 antibody G3QF38 100%
Mouse FOXP3 antibody; Mus musculus FOXP3 antibody Q99JB6 92%
Mouse Foxp3 antibody; Mus musculus Foxp3 antibody Q53Z59 92%
Northern white-cheeked gibbon FOXP3 antibody; Nomascus leucogenys FOXP3 antibody G1R9G1 100%
Northern white-cheeked gibbon FOXP3 antibody; Nomascus leucogenys FOXP3 antibody G1R9F9 100%
Northern white-cheeked gibbon FOXP3 antibody; Nomascus leucogenys FOXP3 antibody G1R9F8 100%
Northern white-cheeked gibbon FOXP3 antibody; Nomascus leucogenys FOXP3 antibody G1R9F2 100%
Pig FOXP3 antibody; Sus scrofa FOXP3 antibody Q6BBQ1 100%
Pig FOXP3 antibody; Sus scrofa FOXP3 antibody F1RW37 100%
Pig FOXP3 antibody; Sus scrofa FOXP3 antibody F1RW29 100%
Pig FOXP3 antibody; Sus scrofa FOXP3 antibody B2RGL0 100%
Rabbit LOC100348270 antibody; Oryctolagus cuniculus LOC100348270 antibody G1SYN1 85%
Rat Foxp3 antibody; Rattus norvegicus Foxp3 antibody D4Q8I3 85%
Rat Foxp3 antibody; Rattus norvegicus Foxp3 antibody D4Q8I2 85%
Rat Foxp3 antibody; Rattus norvegicus Foxp3 antibody D3ZKI1 85%
Rhesus macaque FOXP3 antibody; Macaca mulatta FOXP3 antibody Q5XW17 100%
Rhesus macaque FOXP3 antibody; Macaca mulatta FOXP3 antibody F7FCX6 100%
Rhesus macaque FOXP3 antibody; Macaca mulatta FOXP3 antibody F7FCX1 100%
Rhesus macaque FOXP3 antibody; Macaca mulatta FOXP3 antibody F7CMV8 100%
Sheep FOXP3 antibody; Ovis aries FOXP3 antibody B8Y745 100%
Small-eared galago FOXP3 antibody; Otolemur garnettii FOXP3 antibody H0XS01 92%

Product Protocols: FOXP3 antibody tested with Human Hepg2 Cells (ARP32743_T100)

Aviva Systems Biology is the original manufacturer of this FOXP3 antibody (ARP32743_T100)

Click here to view the FOXP3 antibody Western Blot Protocol

Product Datasheet Link: FOXP3 antibody (ARP32743_T100)

WB Suggested Anti-FOXP3 Antibody Titration: 5.0-8.0ug/ml
Positive Control: HepG2

Western Blot image:

Description of Target: Forkhead box protein P3 (FOXP3, Scurfin, Zinc finger protein JM2) encodes a novel member of the forkhead family of transcription factors. It presumably represses transcription, playing a paramount role in determining the amplitude of the response of CD4 T cells to activation

Questions pertaining to this data can be directed to

Aviva Systems Biology’s FOXP3 antibody (ARP32743_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: FOXP3 antibody tested by IHC with human liver (ARP32743)

Aviva Systems Biology is the original manufacturer of this FOXP3 antibody.

Click here to view the FOXP3 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: FOXP3 antibody (ARP32743)

IHC Information:

Rabbit Anti-FOXP3 Antibody
Catalog Number: ARP32743
Paraffin Embedded Tissue: Human Liver
Cellular Data: Liver cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question