SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP31277_P050
Price: $0.00
SKU
ARP31277_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-FOSL2 (ARP31277_P050) antibody
Product Info
Tested Species ReactivityHuman, Zebrafish
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human FOSL2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
Peptide SequenceSynthetic peptide located within the following region: PMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFY
Concentration0.5 mg/ml
Blocking PeptideFor anti-FOSL2 (ARP31277_P050) antibody is Catalog # AAP31277 (Previous Catalog # AAPP02026)
ReferenceMolven,A., et al., (1996) Genomics 38(1),72-75
Gene SymbolFOSL2
Gene Full NameFOS-like antigen 2
Alias SymbolsFRA2
NCBI Gene Id2355
Protein NameFos-related antigen 2
Description of TargetThe Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2, which encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. The FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation.
Uniprot IDP15408
Protein Accession #NP_005244
Nucleotide Accession #NM_005253
Protein Size (# AA)326
Molecular Weight35kDa
Protein InteractionsGMCL1; GOPC; LUZP4; CREB5; DNAJA3; TRAF1; FHL3; DDIT3; JUNB; UBC; SRA1; ATF1; EP300; SUMO2; JUND; JUN;
  1. What is the species homology for "FOSL2 Antibody - middle region (ARP31277_P050)"?

    The tested species reactivity for this item is "Human, Zebrafish". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "FOSL2 Antibody - middle region (ARP31277_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FOSL2 Antibody - middle region (ARP31277_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FOSL2 Antibody - middle region (ARP31277_P050)"?

    This target may also be called "FRA2" in publications.

  5. What is the shipping cost for "FOSL2 Antibody - middle region (ARP31277_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FOSL2 Antibody - middle region (ARP31277_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FOSL2 Antibody - middle region (ARP31277_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FOSL2 Antibody - middle region (ARP31277_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "FOSL2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FOSL2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FOSL2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FOSL2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FOSL2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FOSL2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FOSL2 Antibody - middle region (ARP31277_P050)
Your Rating
We found other products you might like!