FGFR1OP Antibody - middle region (ARP53670_P050)

Catalog No: ARP53670_P050

WB Suggested Anti-FGFR1OP Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver

Rabbit Anti-FGFR1OP Antibody
Catalog Number: ARP53670_P050
Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
Observed Staining: Cytoplasm in hepatocytes
Primary Antibody Concentration: N/A
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FGFR1OP
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 77%; Rabbit: 85%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LSDVHSPPKSPEGKTSAQTTPSKIPRYKGQGKKKTSGQKAGDKKANDEAN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FGFR1OP (ARP53670_P050) antibody is Catalog # AAP53670 (Previous Catalog # AAPP30512)
• Reference: Mano,Y., (2007) Cancer Sci. 98 (12), 1902-1913

Target Info

• Gene Symbol: FGFR1OP
• Gene Full Name: FGFR1 oncogene partner
• Alias Symbols: FOP, FGFR1OP
• NCBI Gene Id: 11116
• Protein Name: FGFR1 oncogene partner
• Description of Target: FGFR1OP is a largely hydrophilic protein postulated to be a leucine-rich protein family member. A t (6;8)(q27;p11) chromosomal translocation, fusing this gene and the fibroblast growth factor receptor 1 (FGFR1) gene, has been found in cases of myeloproliferative disorder. The resulting chimeric protein contains the N-terminal leucine-rich region of this encoded protein fused to the catalytic domain of FGFR1. This gene is thought to play an important role in normal proliferation and differentiation of the erythroid lineage.This gene encodes a largely hydrophilic protein postulated to be a leucine-rich protein family member. A t(6;8)(q27;p11) chromosomal translocation, fusing this gene and the fibroblast growth factor receptor 1 (FGFR1) gene, has been found in cases of myeloproliferative disorder. The resulting chimeric protein contains the N-terminal leucine-rich region of this encoded protein fused to the catalytic domain of FGFR1. This gene is thought to play an important role in normal proliferation and differentiation of the erythroid lineage. Alternatively spliced transcript variants that encode different proteins have been identified.
• Uniprot ID: O95684
• Protein Accession #: NP_919410
• Nucleotide Accession #: NM_194429
• Protein Size (# AA): 379
• Molecular Weight: 42kDa
• Protein Interactions: CEP19; VASP; BRCA1; WRNIP1; ABL1; UBC; NAGK; FGFR1OP; CEP350; PACS1; PPP2R1A; PPP2R1B; PPP2CB; PPP2CA;