website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

FGF2 antibody - middle region (ARP42005_P050)

Description of Target:
The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors.The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
Fibroblast growth factor 2 (basic)
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express FGF2.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Fibroblast growth factor 2
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
FGF2 antibody - middle region (ARP42005_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Sheep: 93%; Bovine: 93%; Zebrafish: 86%
Species Reactivity:
Human, Rat, Guinea pig, Mouse, Rabbit, Horse, Bovine, Dog, Sheep, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-FGF2 antibody
- ARP42005_P050
Peptide Sequence:
Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Blocking Peptide:
For anti-FGF2 antibody is Catalog # AAP42005 (Previous Catalog # AAPS11410)
Target Reference:
Goodger,S.J., (2008) J. Biol. Chem. 283 (19), 13001-13008
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for FGF2 antibody (ARP42005)

Product page for FGF2 antibody (ARP42005)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog FGF2 antibody; Xenopus laevis FGF2 antibody P12226 85%
African clawed frog fgf2 antibody; Xenopus laevis fgf2 antibody B7ZPK6 85%
African elephant FGF2 antibody; Loxodonta africana FGF2 antibody G3T1G9 100%
Bovine BT.66957 antibody; Bos taurus BT.66957 antibody F1N3T9 92%
Bovine FGF2 antibody; Bos taurus FGF2 antibody P03969 92%
Chicken FGF2 antibody; Gallus gallus FGF2 antibody P48800 85%
Chicken FGF2 antibody; Gallus gallus FGF2 antibody Q07659 85%
Chicken FGF2 antibody; Gallus gallus FGF2 antibody F1NUZ0 85%
Chimpanzee FGF2 antibody; Pan troglodytes FGF2 antibody Q5IS69 100%
Common turkey FGF2 antibody; Meleagris gallopavo FGF2 antibody G3UT45 85%
Common turkey LOC100550388 antibody; Meleagris gallopavo LOC100550388 antibody G1NDN4 85%
Dog BFGF antibody; Canis familiaris BFGF antibody O77767 92%
Dog Cfa.3716 antibody; Canis familiaris Cfa.3716 antibody F1P6K6 92%
Gray short-tailed opossum FGF2 antibody; Monodelphis domestica FGF2 antibody P48798 100%
Green anole FGF2 antibody; Anolis carolinensis FGF2 antibody G1KLM6 85%
Guinea pig FGF2 antibody; Cavia porcellus FGF2 antibody Q60487 100%
Guinea pig FGF2 antibody; Cavia porcellus FGF2 antibody Q60487-2 100%
Guinea pig FGF2 antibody; Cavia porcellus FGF2 antibody H0V5B9 100%
Haddock bFGF-2 antibody; Melanogrammus aeglefinus bFGF-2 antibody B1GRP1 85%
Horse FGF2 antibody; Equus caballus FGF2 antibody E0AEV7 92%
Human FGF2 antibody; Homo sapiens FGF2 antibody P09038 100%
Human FGF2 antibody; Homo sapiens FGF2 antibody P09038-3 100%
Human FGF2 antibody; Homo sapiens FGF2 antibody P09038-2 100%
Human FGF2 antibody; Homo sapiens FGF2 antibody P09038-1 100%
Human FGF2 antibody; Homo sapiens FGF2 antibody D9ZGF5 100%
Japanese common newt fgf-2 antibody; Cynops pyrrhogaster fgf-2 antibody Q98TD8 85%
Japanese common newt fgf-2 antibody; Cynops pyrrhogaster fgf-2 antibody Q90Y92 85%
Little brown bat FGF2 antibody; Myotis lucifugus FGF2 antibody G1Q2C6 92%
Lowland gorilla FGF2 antibody; Gorilla gorilla gorilla FGF2 antibody G3QQ62 100%
Mouse FGF2 antibody; Mus musculus FGF2 antibody P15655 100%
Mouse Fgf2 antibody; Mus musculus Fgf2 antibody Q925A3 100%
Mouse Fgf2 antibody; Mus musculus Fgf2 antibody Q925A2 100%
Mouse Fgf2 antibody; Mus musculus Fgf2 antibody Q925A1 100%
Mouse Fgf2 antibody; Mus musculus Fgf2 antibody Q7TPG9 100%
Mouse Fgf2 antibody; Mus musculus Fgf2 antibody Q541T2 100%
Mouse Fgf2 antibody; Mus musculus Fgf2 antibody A3KG30 100%
Northern white-cheeked gibbon FGF2 antibody; Nomascus leucogenys FGF2 antibody G1RE56 100%
Pig FGF2 antibody; Sus scrofa FGF2 antibody F1RQN3 92%
Rabbit FGF2 antibody; Oryctolagus cuniculus FGF2 antibody P48799 100%
Rabbit FGF2 antibody; Oryctolagus cuniculus FGF2 antibody G1SDD5 100%
Rainbow trout LOC100136280 antibody; Oncorhynchus mykiss LOC100136280 antibody Q5FXK5 92%
Rat FGF2 antibody; Rattus norvegicus FGF2 antibody P13109 100%
Rat Fgf2 antibody; Rattus norvegicus Fgf2 antibody D4A5B7 100%
Rhesus macaque Mmu.3766 antibody; Macaca mulatta Mmu.3766 antibody F6SXE2 100%
Roe deer bFGF antibody; Capreolus capreolus bFGF antibody Q9N1S7 92%
Sheep FGF2 antibody; Ovis aries FGF2 antibody P20003 92%
Small-eared galago FGF2 antibody; Otolemur garnettii FGF2 antibody H0Y0R7 100%
Tasmanian devil FGF2 antibody; Sarcophilus harrisii FGF2 antibody G3W9W0 100%
Three-spined stickleback FGF2 antibody; Gasterosteus aculeatus FGF2 antibody G3PWT9 92%
Western clawed frog fgf2 antibody; Xenopus tropicalis fgf2 antibody Q28DZ3 85%
Western clawed frog fgf2 antibody; Xenopus tropicalis fgf2 antibody F6WSW6 85%
White-tufted-ear marmoset LOC100403642 antibody; Callithrix jacchus LOC100403642 antibody F7C2G7 100%
Zebra finch FGF2 antibody; Taeniopygia guttata FGF2 antibody H0YUW0 85%
Zebrafish fgf2 antibody; Danio rerio fgf2 antibody B3DGE3 85%

Product Protocols: FGF2 antibody tested with Human Jurkat Cells (ARP42005_P050)

Aviva Systems Biology is the original manufacturer of this FGF2 antibody (ARP42005_P050)

Click here to view the FGF2 antibody Western Blot Protocol

Product Datasheet Link: FGF2 antibody (ARP42005_P050)

WB Suggested Anti-FGF2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat

Western Blot image:

Description of Target: The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors.The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s FGF2 antibody (ARP42005_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Review: FGF2 antibody - middle region (ARP42005_P050) in Human A375 cells using IHC

Product page for FGF2 antibody - middle region (ARP42005_P050)

Researcher:Igor Prudovsky, Maine Medical Center Research Institute
Application: IHC
Species+tissue/cell type: Human A375 cells
Primary antibody dilution: 1:100
Secondary antibody: Anti-rabbit-Alexa-546
Secondary antibody dilution: 1:100

How do Aviva’s reagents play a role in your experimental goals? considerable
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4. Antibodies give nice cytoplasmic staining in A375 cells, which have high FGF2 expression and negligible  staining in NIH 3T3 cells (low FGF2). Control immunofluorescence staining of all these cells with non-immune rabbit IgG gave strictly negative results.
Would you use this antibody in future experiments? yes
Have you used another antibody which has worked in your application? yes
Do you believe the information about the reagent on Aviva’s website is correct? Did not check.
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes. Looks like a good antibody for immunofluorescence.
How did you store the antibody after re-suspension? Frozen in aliquots
Sample Description (please include species type and tissue/cell type): A375 melanoma (high FGF2), NIH3T3 (very low FGF2)
Please explain fixation solution/method used (formalin, periodate-lysine-paraformaldehyde, acetone, etc.)? formalin
How many different experimental trials were conducted using the antibody sample? two
Primary antibody dilution, incubation time and temperature: X100, 1h, RT
Secondary antibody used, dilution, incubation time and temperature: Alexa-546 conjugated anti-rabbit IgG
From your IHC/ICC images, briefly explain the colors of each stain and counterstain: Red fluorescence. Also, FAR-red TOPRO3 stain was used to counterstain the nuclei.
Did you use an antigen retrieval method? If so, please explain? no
What controls were used in your experiment? Same cells, where non-immune rabbit IgGs were used instead of primary antibodies
Please include your detailed tissue preparation and staining procedure/protocol here: 15 min 4% formaldehyde.
PBS was.
1 h in blocking buffer: PBS with 5% BSA, 0.1% Triton X100 and 0.1% sodium azide.
PBS wash.
1 h in blocking buffer with X100 dilution of primary Abs.
PBS wash.
30 min in blocking buffer with X100 dilution of Alexa-546 conjugated secondary abs and X1000 dilution of TOPRO-3.
PBS wash.
Embedding and confocal immunofluorescence study.
Ask a Question