website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

FGF2 antibody - middle region (ARP42005_P050)

Description of Target:
The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors.The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
FGF2
Official Gene Full Name:
Fibroblast growth factor 2 (basic)
NCBI Gene Id:
2247
Alias Symbols:
BFGF; FGFB; HBGF-2
Tissue Tool:
Find tissues and cell lines supported to express FGF2.
Protein Accession #:
NP_001997
Nucleotide Accession#:
NM_002006
Swissprot Id:
P09038
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Fibroblast growth factor 2
Protein Size (# AA):
288
Molecular Weight:
31kDa
Application:
IHC, WB
Partner Proteins:
CPE, CTSL1, GCGR, GLP1R, GLP2R, MEP1A, MEP1B, GLP1R
Immunogen:
The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
FGF2 antibody - middle region (ARP42005_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Sheep: 93%; Bovine: 93%; Zebrafish: 86%
Species Reactivity:
Human, Rat, Guinea pig, Mouse, Rabbit, Horse, Bovine, Dog, Sheep, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-FGF2 antibody
- ARP42005_P050
Peptide Sequence:
Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Blocking Peptide:
For anti-FGF2 antibody is Catalog # AAP42005 (Previous Catalog # AAPS11410)
Key Reference:
Goodger,S.J., (2008) J. Biol. Chem. 283 (19), 13001-13008
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-FGF2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question