website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

FGF2 antibody - middle region (ARP42005_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
In Stock
Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Fibroblast growth factor 2 (basic)
Protein Name:
Fibroblast growth factor 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors.The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FGF2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FGF2.
The immunogen is a synthetic peptide directed towards the middle region of human FGF2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 86%
Complete computational species homology data:
Anti-FGF2 (ARP42005_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FGF2 (ARP42005_P050) antibody is Catalog # AAP42005 (Previous Catalog # AAPS11410)
Datasheets / Downloads:
Printable datasheet for anti-FGF2 (ARP42005_P050) antibody
Target Reference:
Goodger,S.J., (2008) J. Biol. Chem. 283 (19), 13001-13008

Product Protocols: FGF2 antibody tested with Human Jurkat Cells (ARP42005_P050)

Aviva Systems Biology is the original manufacturer of this FGF2 antibody (ARP42005_P050)

Click here to view the FGF2 antibody Western Blot Protocol

Product Datasheet Link: FGF2 antibody (ARP42005_P050)

WB Suggested Anti-FGF2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat

Western Blot image:

Description of Target: The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors.The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s FGF2 antibody (ARP42005_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Review: FGF2 antibody - middle region (ARP42005_P050) in Human A375 cells using IHC

Product page for FGF2 antibody - middle region (ARP42005_P050)

Researcher:Igor Prudovsky, Maine Medical Center Research Institute
Application: IHC
Species+tissue/cell type: Human A375 cells
Primary antibody dilution: 1:100
Secondary antibody: Anti-rabbit-Alexa-546
Secondary antibody dilution: 1:100

How do Aviva’s reagents play a role in your experimental goals?considerable
How would you rate this antibody on a scale from 1-5 (5=best) and why?4. Antibodies give nice cytoplasmic staining in A375 cells, which have high FGF2 expression and negligible  staining in NIH 3T3 cells (low FGF2). Control immunofluorescence staining of all these cells with non-immune rabbit IgG gave strictly negative results.
Would you use this antibody in future experiments?yes
Have you used another antibody which has worked in your application?yes
Do you believe the information about the reagent on Aviva’s website is correct?Did not check.
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?Yes. Looks like a good antibody for immunofluorescence.
How did you store the antibody after re-suspension?Frozen in aliquots
Sample Description (please include species type and tissue/cell type):A375 melanoma (high FGF2), NIH3T3 (very low FGF2)
Please explain fixation solution/method used (formalin, periodate-lysine-paraformaldehyde, acetone, etc.)?formalin
How many different experimental trials were conducted using the antibody sample?two
Primary antibody dilution, incubation time and temperature:X100, 1h, RT
Secondary antibody used, dilution, incubation time and temperature:Alexa-546 conjugated anti-rabbit IgG
From your IHC/ICC images, briefly explain the colors of each stain and counterstain:Red fluorescence. Also, FAR-red TOPRO3 stain was used to counterstain the nuclei.
Did you use an antigen retrieval method? If so, please explain?no
What controls were used in your experiment?Same cells, where non-immune rabbit IgGs were used instead of primary antibodies
Please include your detailed tissue preparation and staining procedure/protocol here:15 min 4% formaldehyde.
PBS was.
1 h in blocking buffer: PBS with 5% BSA, 0.1% Triton X100 and 0.1% sodium azide.
PBS wash.
1 h in blocking buffer with X100 dilution of primary Abs.
PBS wash.
30 min in blocking buffer with X100 dilution of Alexa-546 conjugated secondary abs and X1000 dilution of TOPRO-3.
PBS wash.
Embedding and confocal immunofluorescence study.
Ask a Question