FER1L3 Antibody - C-terminal region (ARP46953_P050)

Catalog No: ARP46953_P050

WB Suggested Anti-FER1L3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate.MYOF is strongly supported by BioGPS gene expression data to be expressed in MCF7

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FER1L3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MYOF (ARP46953_P050) antibody is Catalog # AAP46953 (Previous Catalog # AAPP27751)
• Sample Type Confirmation:

  MYOF is strongly supported by BioGPS gene expression data to be expressed in 721_B, HeLa, MCF7

• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Patel,P., (2008) J. Mol. Biol. 379 (5), 981-990

Target Info

• Gene Symbol: MYOF
• Gene Full Name: Myoferlin
• Alias Symbols: FER1L3
• NCBI Gene Id: 26509
• Protein Name: Myoferlin
• Description of Target: Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. FER1L3 is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. The protein encoded by this gene is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. Two transcript variants encoding different isoforms have been found for this gene. Other possible variants have been detected, but their full-length natures have not been determined.
• Uniprot ID: Q9NZM1
• Protein Accession #: NP_038479
• Nucleotide Accession #: NM_013451
• Protein Size (# AA): 2061
• Molecular Weight: 235 kDa
• Protein Interactions: UBC; SUMO2; SUMO3; RPA3; RPA2; RPA1; MATR3; ILF2; ATP6V1B1; CDK2; Kdr; Dnm2; ISG15; SUMO1;