Fbxw7 Antibody - middle region (ARP37443_P050)

Catalog No: ARP37443_P050

WB Suggested Anti-Fbxw7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Mouse Lung

Mouse Brain

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Paraffin embedded mouse brain tissue, tested with an antibody dilution of 5 ug/ml.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse Fbxw7
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: GIDEPLHIKRRKIIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Fbxw7 (ARP37443_P050) antibody is Catalog # AAP37443 (Previous Catalog # AAPP09584)
• Publications:

  Huang, H. et al. NF-κB1 inhibits c-Myc protein degradation through suppression of FBW7 expression. Oncotarget 5, 493-505 (2014). 24457827

Target Info

• Gene Symbol: Fbxw7
• Gene Full Name: F-box and WD-40 domain protein 7
• Alias Symbols: A, AGO, Cdc4, Fbw7, SEL-, Fbwd6, Fbx30, Fbxo3, Fbxw6, Fbxo30, SEL-10, 1110001A17Rik
• NCBI Gene Id: 50754
• Protein Name: F-box/WD repeat-containing protein 7
• Description of Target: Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins. Involved in the degradation of cyclin-E, MYC, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1.
• Uniprot ID: Q8VBV4
• Protein Accession #: NP_536353
• Nucleotide Accession #: NM_080428
• Protein Size (# AA): 629
• Molecular Weight: 70kDa
• Protein Interactions: Skp1a; CREB3L1; CREB3L2; Cul1; Prkcz; Prkce; Prkcd; Prkcb; Prkca; Pten; Mcl1; CEBPA; Pin1; MYB; Npm1; Jun;