FAM82A Antibody - middle region (ARP52753_P050)

Catalog No: ARP52753_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-FAM82A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM82A
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: RAPMNGHCHLWYAVLCGYVSEFEGLQNKINYGHLFKEHLDIAIKLLPEEP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RMDN2 (ARP52753_P050) antibody is Catalog # AAP52753 (Previous Catalog # AAPP33635)
• Reference: Oishi,K., (2007) J. Cell Biol. 179 (6), 1149-1162

Target Info

• Gene Symbol: RMDN2
• Gene Full Name: Family with sequence similarity 82, member A1
• Alias Symbols: RMD2, RMD4, RMD-2, FAM82A, BLOCK18, FAM82A1, PRO34163, PYST9371
• NCBI Gene Id: 151393
• Protein Name: Regulator of microtubule dynamics protein 2
• Description of Target: FAM82A belongs to the FAM82/RMD family. It is a single-pass membrane protein. The function of the FAM82A protein remains unknown.
• Uniprot ID: Q96LZ7
• Protein Accession #: NP_653314
• Nucleotide Accession #: NM_144713
• Protein Size (# AA): 573
• Molecular Weight: 65kDa
• Protein Interactions: CMTM5; AGTRAP; VAPB; UBC;