FAM20C Antibody - middle region (ARP49489_P050)

Catalog No: ARP49489_P050

WB Suggested Anti-FAM20C Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM20C
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: CFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FAM20C (ARP49489_P050) antibody is Catalog # AAP49489 (Previous Catalog # AAPS25112)
• Reference: Simpson,M.A., (2007) Am. J. Hum. Genet. 81 (5), 906-912

Target Info

• Gene Symbol: FAM20C
• Gene Full Name: Family with sequence similarity 20, member C
• Alias Symbols: RNS, DMP4, G-CK, DMP-4, GEF-CK
• NCBI Gene Id: 56975
• Protein Name: Extracellular serine/threonine protein kinase Fam20C
• Description of Target: FAM20C belongs to the FAM20 family. FAM20C is a calcium-binding protein which may play a role in dentin mineralization. Mutations in FAM20C are associated with lethal osteosclerotic bone dysplasia (Raine Syndrome), highlighting a crucial molecule in bone development.
• Uniprot ID: Q8IXL6
• Protein Accession #: NP_064608
• Nucleotide Accession #: NM_020223
• Protein Size (# AA): 584
• Molecular Weight: 66kDa
• Protein Interactions: SUV39H2; FAM118B; TAF1D; TSC22D1; TK1; SMN1; PFDN1;