F2RL1 Antibody - C-terminal region (ARP60034_P050)

Catalog No: ARP60034_P050

WB Suggested Anti-F2RL1 Antibody
Titration: 1.0 ug/ml
Positive Control: MCF7 Whole Cell

Host: Rabbit
Target Name: F2RL1
Sample Tissue: Human Jurkat Whole Cell
Antibody Dilution: 0.5ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Dog, Guinea Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 93%; Guinea Pig: 86%; Human: 100%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: VSHDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-F2RL1 (ARP60034_P050) antibody is Catalog # AAP60034
• Publications:

  Yau, M.-K., Liu, L. & Fairlie, D. P. Toward drugs for protease-activated receptor 2 (PAR2). J. Med. Chem. 56, 7477-97 (2013). 23895492

Target Info

• Gene Symbol: F2RL1
• Gene Full Name: Coagulation factor II (thrombin) receptor-like 1
• Alias Symbols: PAR2, GPR11
• NCBI Gene Id: 2150
• Protein Name: Proteinase-activated receptor 2
• Description of Target: Coagulation factor II (thrombin) receptor-like 1 (F2RL1) is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. F2RL1 is also a member of the protease-activated receptor family. It is activated by trypsin, but not by thrombin. It is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. The F2RL1 gene contains two exons and is widely expressed in human tissues. The predicted protein sequence is 83% identical to the mouse receptor sequence.
• Uniprot ID: P55085
• Protein Accession #: NP_005233
• Nucleotide Accession #: NM_005242
• Protein Size (# AA): 397
• Molecular Weight: 44kDa
• Protein Interactions: BIRC5; COPS5; UBC; Cbl; ST14; GPRASP1; PRTN3; F2; PLG; ELANE; CTSG; CAPN2; CAPN1;