Catalog No: ARP32263_P050
Price: $0.00
SKU
ARP32263_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ETV4 (ARP32263_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ETV4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: HSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYH
Concentration0.5 mg/ml
Blocking PeptideFor anti-ETV4 (ARP32263_P050) antibody is Catalog # AAP32263 (Previous Catalog # AAPP03244)
ReferenceSpan,P.N., et al., (2003) Breast Cancer Res. Treat. 79 (1), 129-131
Publications

An Interaction with Ewing's Sarcoma Breakpoint Protein EWS Defines a Specific Oncogenic Mechanism of ETS Factors Rearranged in Prostate Cancer. Cell Rep. 17, 1289-1301 (2016). 27783944

Capicua regulates neural stem cell proliferation and lineage specification through control of Ets factors. Nat Commun. 10, 2000 (2019). 31043608

Dynamics of chromatin accessibility during TGF-β-induced EMT of Ras-transformed mammary gland epithelial cells. Sci Rep. 7, 1166 (2017). 28446749

ETV4 Is Necessary for Estrogen Signaling and Growth in Endometrial Cancer Cells. Cancer Res. 80, 1234-1245 (2020). 32046982

Hollenhorst, P. C. et al. Oncogenic ETS proteins mimic activated RAS/MAPK signaling in prostate cells. Genes Dev. 25, 2147-57 (2011). 22012618

Hollenhorst, P. C., Paul, L., Ferris, M. W. & Graves, B. J. The ETS gene ETV4 is required for anchorage-independent growth and a cell proliferation gene expression program in PC3 prostate cells. Genes Cancer 1, 1044-1052 (2011). 21373373

Inactivation of Capicua drives cancer metastasis. Nat. Genet. 49, 87-96 (2017). 27869830

Interaction of BRAF-induced ETS factors with mutant TERT promoter in papillary thyroid cancer. Endocr Relat Cancer. 26, 629-641 (2019). 30999281

ME1 Regulates NADPH Homeostasis to Promote Gastric Cancer Growth and Metastasis. Cancer Res. 78, 1972-1985 (2018). 29654155

Selvaraj, N., Budka, J. A., Ferris, M. W., Jerde, T. J. & Hollenhorst, P. C. Prostate cancer ETS rearrangements switch a cell migration gene expression program from RAS/ERK to PI3K/AKT regulation. Mol. Cancer 13, 61 (2014). 24642271

Description
Gene SymbolETV4
Gene Full NameEts variant 4
Alias SymbolsE1AF, PEA3, E1A-F, PEAS3
NCBI Gene Id2118
Protein NameETS translocation variant 4
Description of TargetThe protein encoded by the ETV4 gene is known to play a role in ovarian and breast malignancies as well as in the early stage of colorectal carcinogenesis.
Uniprot IDP43268
Protein Accession #NP_001977
Nucleotide Accession #NM_001986
Protein Size (# AA)484
Molecular Weight54kDa
Protein InteractionsSTK11; RFWD2; TP63; ATXN1; HTT; APP; UBC; SMAD2; SUMO2; SUMO1; SAE1; UBA2; HOXD4; EP300; SRF;
  1. What is the species homology for "ETV4 Antibody - middle region (ARP32263_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "ETV4 Antibody - middle region (ARP32263_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ETV4 Antibody - middle region (ARP32263_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ETV4 Antibody - middle region (ARP32263_P050)"?

    This target may also be called "E1AF, PEA3, E1A-F, PEAS3" in publications.

  5. What is the shipping cost for "ETV4 Antibody - middle region (ARP32263_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ETV4 Antibody - middle region (ARP32263_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ETV4 Antibody - middle region (ARP32263_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "54kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ETV4 Antibody - middle region (ARP32263_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ETV4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ETV4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ETV4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ETV4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ETV4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ETV4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ETV4 Antibody - middle region (ARP32263_P050)
Your Rating
We found other products you might like!