Catalog No: ARP46725_P050
Price: $0.00
SKU
ARP46725_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ERLIN1 (ARP46725_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ERLIN1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 100%; Goat: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: KNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIH
Concentration0.5 mg/ml
Blocking PeptideFor anti-ERLIN1 (ARP46725_P050) antibody is Catalog # AAP46725 (Previous Catalog # AAPP27527)
Sample Type Confirmation

ERLIN1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

ERLIN1 is supported by BioGPS gene expression data to be expressed in 721_B, MCF7

ReferenceBrowman,D.T., J. Cell. Sci. 119 (PT 15), 3149-3160 (2006)
Gene SymbolERLIN1
Gene Full NameER lipid raft associated 1
Alias SymbolsKE04, KEO4, SPFH1, SPG62, Erlin-1, C10orf69
NCBI Gene Id10613
Protein NameErlin-1
Description of TargetErlin-1 belongs to the band 7/mec-2 family. Erlin-1 and erlin-2 are novel members of the prohibitin family of proteins that define lipid-raft-like domains of the ER.
Uniprot IDO75477
Protein Accession #NP_006450
Nucleotide Accession #NM_006459
Protein Size (# AA)348
Molecular Weight39kDa
Protein InteractionsAGR3; TMEM199; FA2H; SEC22A; ERLIN2; Scap; SUMO2; INSIG1; UBC; ASB11; SUZ12; ADRA1D; CFTR; CHCHD6; NDUFA12; CHMP2A; RALY; SSR3; CPT1A; FBXO6; SYVN1; RNF139; ITPR1; AMFR;
  1. What is the species homology for "ERLIN1 Antibody - N-terminal region (ARP46725_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "ERLIN1 Antibody - N-terminal region (ARP46725_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ERLIN1 Antibody - N-terminal region (ARP46725_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ERLIN1 Antibody - N-terminal region (ARP46725_P050)"?

    This target may also be called "KE04, KEO4, SPFH1, SPG62, Erlin-1, C10orf69" in publications.

  5. What is the shipping cost for "ERLIN1 Antibody - N-terminal region (ARP46725_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ERLIN1 Antibody - N-terminal region (ARP46725_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ERLIN1 Antibody - N-terminal region (ARP46725_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "39kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ERLIN1 Antibody - N-terminal region (ARP46725_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ERLIN1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ERLIN1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ERLIN1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ERLIN1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ERLIN1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ERLIN1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ERLIN1 Antibody - N-terminal region (ARP46725_P050)
Your Rating
We found other products you might like!