Catalog No: ARP41470_T100
Price: $0.00
SKU
ARP41470_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-EMP2 (ARP41470_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Cow
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human EMP2
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 82%; Human: 100%
Peptide SequenceSynthetic peptide located within the following region: IQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAF
Concentration1.0 mg/ml
Blocking PeptideFor anti-EMP2 (ARP41470_T100) antibody is Catalog # AAP41470 (Previous Catalog # AAPS09304)
ReferenceWadehra,M., (2005) Dev. Biol. 287 (2), 336-345
Gene SymbolEMP2
Gene Full NameEpithelial membrane protein 2
Alias SymbolsXMP
NCBI Gene Id2013
Protein NameEpithelial membrane protein 2
Description of TargetEpithelial membrane protein-2 (EMP2) is a member of the four transmembrane superfamily (TM4SF) and is thought to mediate trafficking of diverse proteins such as alpha6beta1 integrin and MHC class I to lipid raft microdomains. EMP2 has also recently been recognized as a putative tumor suppressor gene in certain model systems.
Uniprot IDP54851
Protein Accession #NP_001415
Nucleotide Accession #NM_001424
Protein Size (# AA)167
Molecular Weight19kDa
Protein InteractionsEPM2AIP1;
  1. What is the species homology for "EMP2 Antibody - middle region (ARP41470_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Cow".

  2. How long will it take to receive "EMP2 Antibody - middle region (ARP41470_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "EMP2 Antibody - middle region (ARP41470_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "EMP2 Antibody - middle region (ARP41470_T100)"?

    This target may also be called "XMP" in publications.

  5. What is the shipping cost for "EMP2 Antibody - middle region (ARP41470_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EMP2 Antibody - middle region (ARP41470_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EMP2 Antibody - middle region (ARP41470_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "19kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EMP2 Antibody - middle region (ARP41470_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "EMP2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EMP2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EMP2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EMP2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EMP2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EMP2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EMP2 Antibody - middle region (ARP41470_T100)
Your Rating